CAZyme Information: EEU46116.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU46116.1
• CAZy Family: GT2
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7YR13]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	GG698898|CGC2	72666.32	6.4037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698898:2560359-2562295(+)

Full Sequence      

MWSLVSFRTSQRRQLFSVAALVFFFFCAYTLLRIPPDQSERYQVQTQRQEQAPIQPQSTP
GSEDKASTEGSPNPKAVPESGVHPITYLVKNAQREFEEVKARQSKSLQEAVVEYRRRYGM
PPPPHFDKWYQFAKDNGVKLIDEFDTIYDLITPFWGLRPKTIRARAREALGFDNGLIGVS
IRDHKITYIQNGVEWQQNATKGMMTKFLQYLPDMDLAFNFHDESRVILSHEDLARLVKTA
KEKYMPAAFAAEKPANDFTKTNSELHDGKSFEETTLSRFNFFAHQSTWSHSRLSCPPDTP
ARSIEDDESVDYRSRYGMSDLGFVYNTTAMSDICLSPSLRSTFGFFGGPNSYGIVQDLFP
IFSQSKISSYSDLLYPSTWDWAGKVEYDEDMDMEWAKKESKLYWRGSTTGGYSRDGRWRR
QHRQRLVQKLNARDQAHVLTSQSAPPWGASEVPRGEYRDLVDVHFSHIGQCDPGDCEAQR
AFFNVTDAVDQQDAWRNKYLLDMDGNAFSGRFGAFLRSKSLVFKLAVFREWHAEWLRPWA
HYVPFSVQGDDWLEAVRFFDSEETARGEGERIAMASREWANQAFRQVDMEAWFFRLMLEY
ARVIDDKREAIGYDRASANKKLPTTEGTD

Enzyme Prediction     

No EC number prediction in EEU46116.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	337	604	1e-76	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	8.03e-19	360	602	32	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	8.27e-08	360	602	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK90133.1|GT90	0.0	1	629	1	632
QPC64756.1|GT90	0.0	1	623	1	621
CEI39398.1|GT90	0.0	1	623	1	621
CZS73133.1|GT90	0.0	1	623	1	621
CEF84213.1|GT90	0.0	1	623	1	621

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	2.71e-07	360	604	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	1.28e-06	360	615	118	354	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	2.98e-52	64	621	133	673	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	1.95e-07	356	604	159	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|Q8T045|RUMI_DROME	1.43e-06	360	604	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|B0X1Q4|RUMI_CULQU	3.24e-06	360	604	164	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	7.31e-06	360	615	146	382	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000002

TMHMM  Annotations     

Start	End
13	32