CAZyme Information: EEU44522.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU44522.1
• CAZy Family: PL9
• CAZyme Description: Carbohydrate-binding module family 18 protein [Source:UniProtKB/TrEMBL;Acc:C7YV57]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
352		35684.73	4.3359

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698900:2047533-2048790(+)

Full Sequence      

MEFSLLFLCIFSLALASFPHDFGFSSPLILPRATNPTSKDGNCGSNSETNATCLTSTFGN
CCSEKGFCGKTSAYCAEGCQDAFGTCSSMPDGQLVSTSGSCGATSTSNVTCQGSTYGNCC
SELGYCGKNSTYCGDGCQSEFGTCSSSDDESSTTTAESDKTSTSTAASSTSSGAISIDGN
CGSNSDINAICKGSEFGDCCSGLGYCGGNSSYCDTGCQSEFGSCYSTSSSTSSSTGPSTT
ASTDSSTTSSAASSTGSSLSTGAKAGIAVGSIIGGLGAIGLLAWLLIRRKNAKKPSSLEK
MDSGAGIHNDGARYEMHEQPLVELPAGYDREQDMKRVDDRAAAGYDGAYRGH

Enzyme Prediction     

EC	-	-	-

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
211316	ChtBD1_1	9.93e-08	47	86	4	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	1.88e-07	105	142	4	41	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
211316	ChtBD1_1	1.71e-06	181	224	2	43	Hevein or type 1 chitin binding domain; filamentous ascomycete subfamily. Hevein or type 1 chitin binding domain (ChtBD1), a lectin domain found in proteins from plants and fungi that bind N-acetylglucosamine, plant endochitinases, wound-induced proteins such as hevein, a major IgE-binding allergen in natural rubber latex, and the alpha subunit of Kluyveromyces lactis killer toxin. This domain is involved in the recognition and/or binding of chitin subunits; it typically occurs N-terminal to glycosyl hydrolase domains in chitinases, together with other carbohydrate-binding domains, or by itself in tandem-repeat arrangements.
395135	Chitin_bind_1	4.56e-04	117	139	14	36	Chitin recognition protein.
395135	Chitin_bind_1	4.93e-04	42	80	1	35	Chitin recognition protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK94823.1|CBM18	1.25e-137	1	352	1	345
QGI78660.1|CBM18	4.31e-110	1	352	1	352
QGI61474.1|CBM18	4.31e-110	1	352	1	352
CCT65321.1|CBM18	4.31e-110	1	352	1	352
QGI92372.1|CBM18	4.31e-110	1	352	1	352

PDB Hits     

EEU44522.1 has no PDB hit.

Swiss-Prot Hits     

EEU44522.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000235	0.999738	CS pos: 16-17. Pr: 0.9706

TMHMM  Annotations     

Start	End
265	287