CAZyme Information: EEU44007.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU44007.1
• CAZy Family: GH71|CBM24|CBM24
• CAZyme Description: DUF2264 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7YVJ6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
528		60078.76	7.1458

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698901:40078-41722(-)

Full Sequence      

MAGLAGFTDNPFRDRSDLVRAAIALIQPLGVYRSPARARVKLLPSTAAAFDDVAAQLEGF
ARPLWAVHALVSDDGSNDIGEAHSWIQGIQAGVDPSSSEYWGDVGPFDQRMVEMESIAFA
LLTAPDVMMRLWCQESKLNLTKWLRQINDHAMPRNNWRWFRILVNLALVKVLGVPHDEVR
RMMDEDFAVLDEFYLGQGWSSDGVWGDERKQADYYSGSFAIQFAQLLYIRFAQGDEERVQ
MYRQQAVEFASQYWRYFDINGAAIPFGRSMTYRFAFGAFWAALALADVPLISPMGSLGCI
KGMLLRHLRWWSKKPEIFNSDGTMNIGFAYPNMYMAEDYNSRQSVYWCLKSFIVLGLPEG
HHFWTCKEEPHPMAKLGLSKQLQIELPTTLQAIWPPHHILCNSHEHHYLLSSGQMTTKKF
KAREAKYGKFAYSSAFGFSVPSGPELHQLASDSTLSISLDDGETWKVRWQPFDVRLQTAS
VRSNGDLHKVPAISSVWKPFKHLGVEIETILIPLTPHFPGWHIRLHKL

Enzyme Prediction     

No EC number prediction in EEU44007.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH154	14	370	2.1e-119	0.9971264367816092

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
401852	DUF2264	2.63e-167	14	371	1	351	Uncharacterized protein conserved in bacteria (DUF2264). Members of this family of hypothetical bacterial proteins have no known function.
226739	COG4289	7.62e-88	10	483	23	452	Uncharacterized protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK98250.1|GH154	0.0	1	528	1	531
CEI67993.1|GH154	7.79e-266	1	526	1	519
QKD60238.1|GH154	8.81e-261	1	528	1	521
QGI87851.1|GH154	1.55e-259	1	528	1	521
CCT75107.1|GH154	1.55e-259	1	528	1	521

PDB Hits     

EEU44007.1 has no PDB hit.

Swiss-Prot Hits     

EEU44007.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000013

TMHMM  Annotations     

There is no transmembrane helices in EEU44007.1.