CAZyme Information: EEU43003.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU43003.1
• CAZy Family: GH5
• CAZyme Description: Trehalase [Source:UniProtKB/TrEMBL;Acc:C7YYG7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
686	GG698903|CGC4	77887.01	4.4258

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698903:377698-379861(+)

Full Sequence      

MGAVRHVATALAASVTAVSALYVNGSVIAPCDSPIYCHGDILEQVELAQPFSDSKTFVDM
PAIRPLEEIQEAFDKLEKPLRNNSELADFLDENFADAGGELEEVPEDELETDPEFLDKID
DTVIKEFTEKVIDIWPDLTRRYNSDSNNCTECPNSFIPINRTFVVAGGRFREPYYWDSYW
ILEGLLRTGGSFVEIAKNTIENFLDFVEEYGFVPNGARIYYLNRSQPPLLAQMVKIYVQH
TNDTDILERALPLLVKEHEFWMTNRTAEVYINDETFLLNRYDVSNTRPRPESYREDYVTA
NNKSYYSAEGDVFPEEEKLDEKQKEKLYGNLASGAESGWDYTSRWIARPQDAARDNYFPL
RYLNTREIIPVDLNSILYGNEIAIADFYANAGNTSASEQWREVAANRSYAMTTFLWNETL
WSYFDYNITSQSQNIYVPEDEDTETIEKTTAPKGKQVLFSVSQFYPFWLGAAPDYLMRNP
FAVLNAYSRVAEYLDTKAGGIPATNFRTGQQWDQPNVWPPLMHILMAGLQNVPPTFGIMD
PSFIELRRLALKLGQRYLDSTFCTWYATGGSTSETPQLRGLSDADEGIMFEKYADNATNV
AGGGGEYEVVEGFGWTNGVLLWAVDTFANRLERPDCGDIEAAHVEGGGGKRSLSAVMLHA
RDAKRVKKFGRRKRATMKRSSRSFWG

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	51	626	7.4e-163	0.9938900203665988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	6.49e-147	51	621	3	502	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	9.86e-129	50	621	26	538	alpha,alpha-trehalase
224541	TreA	1.51e-89	33	633	53	558	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	5.80e-82	10	628	22	537	alpha,alpha-trehalase TreA.
183934	treF	2.39e-79	40	619	61	538	alpha,alpha-trehalase TreF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK93464.1|GH37	0.0	1	686	1	686
CEI68535.1|GH37	0.0	5	684	5	686
QPC78964.1|GH37	0.0	5	685	5	687
QPC61619.1|GH37	0.0	5	684	5	686
CZS84277.1|GH37	0.0	5	685	5	687

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	7.08e-70	53	621	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	9.86e-69	53	621	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	1.60e-68	39	641	15	514	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	4.18e-67	33	635	46	547	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	5.97e-65	39	641	15	514	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	2.04e-122	21	636	39	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|O43280|TREA_HUMAN	2.22e-110	30	631	27	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q9JLT2|TREA_MOUSE	2.79e-109	30	631	24	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|P19813|TREA_RABIT	1.76e-107	30	631	27	553	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|A8J4S9|TREA_APIME	2.59e-106	22	635	32	576	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.226720	0.773266	CS pos: 20-21. Pr: 0.6074

TMHMM  Annotations     

Start	End
7	29