CAZyme Information: EEU42596.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU42596.1
• CAZy Family: GH47
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:C7YZG0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
842		91620.00	5.2284

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698904:311644-314332(+)

Full Sequence      

MGSLHFTTPSREKLLQDMTTSEKIALLSGVDFWHTAGIPHLNLPKLRMSDGPNGVRGTKF
FDSVPAACLPCGTALGATWSRELMKEAGDLIVRECHAKSAHVWLGPTVNIQRSPLGGRGF
ESFSEDPLLSGIMAGAVISSVQKGGIASSLKHFVANDMEHERTLVDCRISQRALREIYLL
PFQLAIRDANPWALMTAYNRVNGTHMCENAEILQDIVRREWNYDGCILSDWFGTYSTVEA
INAGLDLEMPGPTEWRGKKVSTAMSVGKISNDTINQRASSVLKLIERCSKSGIPESGPEI
CLDSESGRDVLRRLGSESIVLLKNERNILPLDSAKSLAVIGPNLKKPFFCGGGSASLRPY
RSVSILEGLNAQLEKPVQYAEAWRIYNMLPVLGDLVRSPTSGKLGHFLMSIYSSPPLEDK
HTLLETFELDDTNVVLYDYSNAATPDNVLFATIEADFVVEQAETYAFGLTVAGTAKLYLD
DNLIVDNAEKQIRGESFFGSGSVEEIGYTELEAGKVYRLRVDFGSAATSNLNKAGAPVFG
AGGVRIGCAPCVDQGSDLDKAVELAKTVDQVVLSVGLGPEWESEGSDRTELGLPGRQAEL
ISRVCAVNGNVVVVIQSGTPVSGPWNEVPAVVQAWYGGNESGHSIADVLLGKTSPSGKLP
LSWPMHIEDTPAFLSYRSEAGRCYYTEDIHVGYRFYEKTKRPVQWPFGHGLSYASFELDH
LTLTMDGSGLDSQLHISVTVTNTSTIDGSETCQAYVKRISESKVSRPIKELKGFTKVFVP
AGETKLAYITIPLKYATSIWDETSGTWLMESGSFEVLVGNSSALTPLSSLFHVATSLEWK
GI

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	36	250	5.9e-63	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	6.32e-68	70	823	121	755	beta-glucosidase BglX.
224389	BglX	1.58e-65	31	380	48	394	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	4.18e-48	319	693	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.03e-43	3	820	46	770	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.37e-37	69	284	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK94797.1|GH3	0.0	1	842	1	875
QKD63131.1|GH3	0.0	1	842	1	849
QKD57157.1|GH3	0.0	6	842	4	868
CCT75990.1|GH3	0.0	1	842	1	875
QGJ02135.1|GH3	0.0	1	842	1	875

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.70e-237	12	842	7	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.90e-233	12	842	7	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.65e-130	12	838	6	673	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.97e-125	15	822	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.07e-87	13	840	6	720	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WU49|BGLI_ASPFU	7.49e-279	12	842	7	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	7.49e-279	12	842	7	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	2.13e-278	12	842	7	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	2.43e-277	12	842	7	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.88e-276	12	842	7	839	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999104	0.000939

TMHMM  Annotations     

There is no transmembrane helices in EEU42596.1.