CAZyme Information: EEU42120.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU42120.1
• CAZy Family: GH43
• CAZyme Description: Oxidoreductase [Source:UniProtKB/TrEMBL;Acc:C7Z270]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	GG698906|CGC5	41529.85	6.0121

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698906:767124-768290(-)

Full Sequence      

MSGKTYNVGIIGYGASAKTFHIPFLTQTPQLKLYSIVQRSPKDGNSAPHDYPDIKHYTDY
KQLLADPAVDLVVVSTPPGNHFELTKAALEAGKHVLTEKPFVPTSTEADQLIDIAKKNGK
LLIVYQNRRWDNDFVTVKKLISEGTIGRIVQFDTHFDRYRPTPSNNWKLDLTIAQGGSAL
FDLGTHLIDQAYHLFGKPQAVHGRLLNQRSGKFDFENPDGVSAELTYPDGLLVNIRISVM
SAEADQPRFWVRGTKGSFRKFGLDTQEEQLQSGKKATDADFGKDDPKHLKLVLVGDDGVP
KEQPAPILEPVTYKAFYAQLAKAIESGREEDVPVSATDARDVLQLIEAVFESAKTGKDIT
FAYFSRDIDEFDE

Enzyme Prediction     

No EC number prediction in EEU42120.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	7	154	3.3e-20	0.38847117794486213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
183212	PRK11579	3.76e-99	8	362	7	346	putative oxidoreductase; Provisional
223745	MviM	4.10e-79	3	357	1	336	Predicted dehydrogenase [General function prediction only].
182305	PRK10206	1.46e-67	5	353	1	335	putative oxidoreductase; Provisional
396129	GFO_IDH_MocA	3.12e-32	7	125	2	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
275173	myo_inos_iolG	1.20e-28	5	357	1	327	inositol 2-dehydrogenase. All members of the seed alignment for this model are known or predicted inositol 2-dehydrogenase sequences co-clustered with other enzymes for catabolism of myo-inositol or closely related compounds. Inositol 2-dehydrogenase catalyzes the first step in inositol catabolism. Members of this family may vary somewhat in their ranges of acceptable substrates and some may act on analogs to myo-inositol rather than myo-inositol per se. [Energy metabolism, Sugars]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBI33503.1|GH109	2.26e-13	50	270	49	296
CCO12039.2|GT4	2.60e-13	7	202	3	199
BBH22343.1|GH109	7.23e-13	1	153	1	152
AZN43264.1|GH109	2.45e-12	1	258	12	295
QLG36866.1|GH109	4.16e-12	51	258	50	284

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3KUX_A	6.14e-75	8	347	10	334	Structure of the YPO2259 putative oxidoreductase from Yersinia pestis [Yersinia pestis]
3GDO_A	1.59e-70	1	359	1	346	Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GDO_B Crystal structure of putative oxidoreductase yvaA from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
3GFG_A	8.11e-70	5	359	14	355	Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_B Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_C Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_D Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_E Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_F Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_G Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_H Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_I Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_J Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_K Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168],3GFG_L Structure of putative oxidoreductase yvaA from Bacillus subtilis in triclinic form [Bacillus subtilis subsp. subtilis str. 168]
3FHL_A	1.05e-65	1	357	1	349	Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_B Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_C Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343],3FHL_D Crystal structure of a putative oxidoreductase from bacteroides fragilis nctc 9343 [Bacteroides fragilis NCTC 9343]
3E82_A	4.93e-60	1	356	3	340	Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_B Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_D Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665],3E82_E Crystal structure of a putative oxidoreductase from Klebsiella pneumoniae [Micrococcus luteus NCTC 2665]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P77376|YDGJ_ECOLI	5.90e-73	8	354	7	338	Uncharacterized oxidoreductase YdgJ OS=Escherichia coli (strain K12) OX=83333 GN=ydgJ PE=1 SV=2
sp|O32223|IOLW_BACSU	3.23e-69	5	359	13	354	scyllo-inositol 2-dehydrogenase (NADP(+)) IolW OS=Bacillus subtilis (strain 168) OX=224308 GN=iolW PE=1 SV=1
sp|O42896|YBQ3_SCHPO	8.53e-69	10	359	8	366	Uncharacterized oxidoreductase C115.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC115.03 PE=3 SV=1
sp|O13991|YEG9_SCHPO	7.22e-64	10	359	8	365	Uncharacterized oxidoreductase C26H5.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC26H5.09c PE=2 SV=3
sp|P46853|YHHX_ECOLI	3.85e-52	7	353	4	336	Uncharacterized oxidoreductase YhhX OS=Escherichia coli (strain K12) OX=83333 GN=yhhX PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EEU42120.1.