CAZyme Information: EEU41581.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU41581.1
• CAZy Family: GH35
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7Z318]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
206	GG698907|CGC3	22506.61	6.1105

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698907:626441-627119(+)

Full Sequence      

DLRVLPIGDSITWGAQSSDSNGYRKYLWDRLAKLENKLDFVGRRADNVGMSDPDHEGHRG
KVIDEISDLASIGISAAPNIVLLHAGTNDMNKDLKTGEAPARLKKLIDKILKVSPKAVVL
VCQIVPSTKAQTTQPRIETFNAAIPGLVSDLRSEGKKALVVAMNEAVQLSDIADDLHPND
RGYQKMSNEFYDAIQLASSMGWITDP

Enzyme Prediction     

No EC number prediction in EEU41581.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	2	194	6e-58	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	3.01e-49	2	194	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238141	SGNH_hydrolase	2.21e-19	4	193	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404371	Lipase_GDSL_2	5.35e-19	7	185	2	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
395531	Lipase_GDSL	6.19e-13	4	190	1	224	GDSL-like Lipase/Acylhydrolase.
238872	SGNH_hydrolase_like_2	3.17e-09	3	190	3	188	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCW80351.1|CE3	1.19e-56	1	206	317	521
ALC25808.1|CE3	4.47e-56	1	206	291	495
AXI75491.1|CE3	6.17e-56	2	206	292	495
QDO17280.1|CBM13|CE3	2.33e-55	2	206	35	237
QDN84982.1|CBM13|CE3	2.33e-55	2	206	35	237

PDB Hits     

EEU41581.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9RLB8|CESA_RUMFL	4.81e-11	2	195	44	261	Multidomain esterase OS=Ruminococcus flavefaciens OX=1265 GN=cesA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EEU41581.1.