CAZyme Information: EEU41259.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU41259.1
• CAZy Family: GH31
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7Z458]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
634	GG698909|CGC1	68430.84	4.6190

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698909:689321-691671(+)

Full Sequence      

MAALATFCQLAAAIPSRGNSSDYEYIVVGSGAGGGTVAATLARKGHSVFLIEAGGDHGDD
LIQEIPSRASTAIENSEMAWHFYINNYRNQTQGRRDSKYTYRLSDGTLYYGLDPPAGAEP
HCALSLGTLYPRGATVGGSTQINALNWAAASDKDWDLIAEYTGDDSWSAEAMKPYFKALE
NRTYREEGLGFDGFISTNRNNVSYITGRPDLAAFMSNAIRHTEGVNVSGIDHLTELLQRD
VNDPLYSYTPGAYQLSVAETEDRRRSGARNYIVDTIEAGYPLTLSTHSLASKILFNRSGS
APRAVGVEYLVGEALYGADPRYNVSQTGQVKTVRASREVIVSGGVFNTPQLLKLSGVGPR
EELESFGIDVIVDSPSVGKYLQDHTEAIVVVNATEPWSNNPNTNCTGQFDSTDPCFVEWK
NSGTGPYGEGAAPLSIRHRSSQSEDEEIDLWIYGFTGAIVRGWYPGFSRALPAPSALSFA
IIKTQTPGDESSGTVTLRSANPRDTPDIVVDWLQGGHGERDLEILTEGAELLYSIMEDSP
TPPSPFSRVQPGEGVDVAQNLKDEAFGHHGGCTCRMGPGNSLDHCVDSELRVNGVQGLRI
VDMSVFPRVPGAFPQQSTYVMALKVADTISQSGV

Enzyme Prediction     

No EC number prediction in EEU41259.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	22	631	1.4e-96	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	2.46e-62	20	629	3	531	choline dehydrogenase; Validated
225186	BetA	1.07e-60	22	629	7	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.76e-26	489	624	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.19e-24	128	386	19	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	2.93e-23	5	621	38	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92385.1|AA3	0.0	1	634	7	638
UPK89191.1|AA3	9.17e-222	4	632	6	639
CCT74373.1|AA3	4.54e-219	1	632	3	637
QGI87149.1|AA3	4.54e-219	1	632	3	637
QGI69807.1|AA3	9.12e-219	1	632	3	637

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4H7U_A	7.18e-37	22	632	40	600	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	6.39e-31	21	629	1	562	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
5OC1_A	8.51e-31	22	629	1	561	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
6ZE2_A	4.84e-27	21	631	4	584	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5ZU2_A	4.41e-26	19	629	3	569	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4K4K7|BETA_PSEF5	9.09e-45	20	629	2	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1
sp|C3K3D3|BETA_PSEFS	2.33e-44	20	629	2	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) OX=216595 GN=betA PE=3 SV=1
sp|Q3K5H3|BETA_PSEPF	2.53e-42	20	629	2	533	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1
sp|A0A1U8QYA8|CICC_EMENI	3.25e-42	18	629	31	607	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q4ZM63|BETA_PSEU2	6.52e-42	21	629	5	535	Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.984903	0.015147

TMHMM  Annotations     

There is no transmembrane helices in EEU41259.1.