CAZyme Information: EEU40647.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU40647.1
• CAZy Family: GH3
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7Z671]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
908	GG698910|CGC20	100805.26	6.0419

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698910:551712-554534(-)

Full Sequence      

MKLIHSFSSLWGIFLHLLLLDTTTLVYSHPHDVFHHRHQAKANDSLGDLDGLELPVLEKR
ALPDLRVMALGASIVFGVGSTDGNGFRKLLRDQLRFSGYKVDMVGTKNGGSMKDNDVEAT
SGFIVKQIHDASKLSYKYKPNLVVINAGTNDIVGNIDPAGQPQRLKSMLLDLWSNISPDT
VIIVSTILPVDKPAAEALRGGVNNGYRNVVSDLYKEGKPIYLADLDGWMTLSDLDDGTHP
TDYGFRKMAGALWSAIQKAEKENKLKDPLPADFSNDNGKTCRKSPGDGINAGALTQKGSG
YDDGTYEHDSQEMGALLTITSDWDRDQWFFARIFRSDRDDLLGWVENSAGNVVYAVRRND
GGGKFTKIATDLNVNDNCKPKGVVFIDLNGDGLDDFACIGPDGAVYASINQGNGGGDKPP
SFVYKGLWRAADSRFPQAKVRLADIDGDGRADFCGLSDNGDVYVWRNGWINDMPEYWQAL
GKRFEGKGMGNLEGTRFEDLNGDGRDDWIWVGDKGEAHTWTNSRSCGVGKEGNGLKVAWR
PGYYKGKTSGPTHAGGFASGIRNRIHFARIYGEPQDFGLLGRLDYVYMEHTKGSNGKHTF
RMRVWKNKGYGATKPKADGNKYCDMTGNGRDDYVWVLSKGEMDFYPNGGKNFITGSESYW
GPMQKAFFKPDRDLDRRDLHLTDWDGDGKCDIVWVDPNNQNRVSVWRNNYTPGGGFNWQY
LANPAPELYCPEKRGIGFHDIPVQFADVSGSGRSDYLCIEKNGRIWGWTQDAKGAWTYID
QFFSSKKHDRANMRFADVDGDGRDDAIWVEKFSGDAFVYYNMGRRDIAGSRYWWEIQERG
GPFPAYGGSYAGSCQYFPDLNGDGRADLHSIQGTFPNTAVSAYNVCDGNRSGDDSTDIKQ
PDLIMPPS

Enzyme Prediction     

No EC number prediction in EEU40647.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	65	256	8e-48	0.9948453608247423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	1.59e-32	65	256	1	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	9.13e-14	69	247	1	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	1.56e-11	67	255	1	187	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
239945	SGNH_hydrolase_like_4	5.98e-10	66	256	2	183	Members of the SGNH-hydrolase superfamily, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
225353	TesA	8.17e-10	57	262	1	214	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK91538.1|CE0	0.0	1	907	1	905
EAA58486.1|CE0	2.15e-293	64	903	60	916
EAA66327.1|CE0	5.79e-264	65	907	59	867
ABA65775.1|CE0	7.86e-259	65	907	59	916
AAD34550.1|CE0	7.86e-259	65	907	59	916

PDB Hits     

EEU40647.1 has no PDB hit.

Swiss-Prot Hits     

EEU40647.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999734	CS pos: 28-29. Pr: 0.9684

TMHMM  Annotations     

There is no transmembrane helices in EEU40647.1.