CAZyme Information: EEU40519.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU40519.1
• CAZy Family: GH3
• CAZyme Description: GPI mannosyltransferase 2 [Source:UniProtKB/TrEMBL;Acc:C7Z5H3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	GG698910|CGC3	45646.41	7.8382

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698910:3539614-3540930(+)

Full Sequence      

MNILNHTTHPILTLTAAFTGWKTLLLSIAIGASIGPDYDTSTSLFFEAVHGDDAPGHASL
AARLTRWDALYFMHDAHVGKVFEQEWAFGVGLPVVVRGVRHLLGVDALEATVAVVVSHVS
HLIAVLALYQLTVVLFGNRRLAFLAAAVHIFSPAGLFLSAPYAEGTFSCLSFIGNLLFAI
SFKNGPDSLQRNAAVVGAGLAYGISATFRSNGLFGGILFAVEAIKNLLALTNGFTISKVL
RLVAPVIGGLLVAVGFVAPQVIAWMRYCNVEGELRPWCVRLMPSIYTFVQEEYWDVGFLK
YWTPNQIPLFLLAAPMLTLLIKSGTELMGESNLSLRATDSQGRVLVRTLAGMQTLLAVLA
ITNYHVQIISRLSSGYPAWYWWVASCLMDEKRSSLGYGIVVFITMYAAIQGGLFASFLPP
A

Enzyme Prediction     

No EC number prediction in EEU40519.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	18	421	4.4e-110	0.9877149877149877

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	5.25e-35	64	421	57	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.21e-19	66	421	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK97415.1|GT76	1.21e-283	1	421	1	420
CEF85209.1|GT76	3.16e-222	1	421	1	423
CEI41323.1|GT76	8.41e-222	1	421	1	421
QPC63474.1|GT76	9.04e-222	1	421	1	423
CCT64606.1|GT76	1.49e-221	1	421	1	427

PDB Hits     

EEU40519.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I0K3|GPI18_GIBZE	5.62e-223	1	421	1	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	7.17e-111	8	421	16	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q2UJS7|GPI18_ASPOR	5.44e-89	2	421	11	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	5.26e-88	3	421	22	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	6.98e-51	13	421	6	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.977227	0.022789

TMHMM  Annotations     

Start	End
12	34
114	136
141	163
199	221
242	264
302	324
344	366
396	418