CAZyme Information: EEU38906.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU38906.1
• CAZy Family: GH18
• CAZyme Description: SGNH_hydro domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7ZAR7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
798		87726.75	7.6082

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698913:53060-55657(-)

Full Sequence      

MPLGASTVFGVGSSDGNGFRKLVRDQARFAGYEVNMVGTKNGGTMKDNDCEATSGHIVTE
AHDASRLSYKFKPNVVIMNIGTNNCIHGIDNANQHNRLRVMIEGMWRNISPDTVMIVSTL
LPLEGQGGVNRNDVNNLYRRMVADLAAQGRPIYIADMDHIPMSDVPDKVHPHDGGFGKMA
AAFWAGIQAAERDGNIKPPLPMDGNAEGDTGTCKKPAGNGVWAGGLTQRGSGEHDGIYRH
RSQPEGVVLTITSDFDRNQWRFARLFRSDRDDLVGWFDLPSGEARDGVWRNDGGGKFTKI
NDLSVQDNCLPRGIVFIDLNGDGHDYFACIGRDGAVFASINRGNGGGAVPPTFRHISLWK
AAQPGYPQAQVRLADIDGDGRADFCGLSLNGDISCWRNGGIHDKPAYFQALGRRFTGKGM
GDLAGVRFEDLNGDDRDDWLWGVEGDGLNVAWRQGFNGNANSGPTHPGGFGGSENIRNRI
HFARIFGVPQDFGLLGRLDYVYMEHAKEGNKHKFSVRVYRNLGSGGTKLVADGNKYCDMT
GNGRDDYVWTHSKGIMTMFPNGGKNFLTGSESYWGPSARIFDAKQVAGRELDRRDLHLAD
WVGDGKCDIIWVDAANENRVTVFRNLDGGAGGNWRWQNLGNAAPALRYPEKRGIGLHDLA
VRFADISGSGRPDYLCIEKDGRVWGWTQSSNGAWTHVPQFKSAKGHDRANLRFHDAEKFS
GDGFVYYNLGRHDIGGSQYWWEQKPGGGGGGAVPCLRWQPGWDLHVLPGPGRQRTSRHAW
YQGHVDQRSRDMVQYVLG

Enzyme Prediction     

No EC number prediction in EEU38906.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	1	186	3.7e-41	0.9742268041237113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.87e-26	47	187	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	6.15e-08	3	171	2	169	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	4.98e-07	3	185	4	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
404411	VCBS	5.57e-05	318	384	1	59	Repeat domain in Vibrio, Colwellia, Bradyrhizobium and Shewanella. This domain of about 100 residues is found in multiple (up to 35) copies in long proteins from several species of Vibrio, Colwellia, Bradyrhizobium, and Shewanella (hence the name VCBS) and in smaller copy numbers in proteins from several other bacteria. The large protein size and repeat copy numbers, species distribution, and suggested activities of several member proteins suggests a role for this domain in adhesion (TIGR).
238869	Endoglucanase_E_like	0.002	73	188	56	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK91538.1|CE0	0.0	1	739	66	830
EAA58486.1|CE0	3.38e-224	1	739	64	850
EAA66327.1|CE0	6.35e-208	1	739	62	797
ABA65775.1|CE0	2.05e-203	1	739	62	846
AAD34550.1|CE0	2.05e-203	1	739	62	846

PDB Hits     

EEU38906.1 has no PDB hit.

Swiss-Prot Hits     

EEU38906.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000077	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EEU38906.1.