CAZyme Information: EEU38415.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU38415.1
• CAZy Family: GH16
• CAZyme Description: LysM domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7ZC40]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1348	GG698917|CGC1	147644.91	7.0189

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698917:36627-41321(+)

Full Sequence      

MWLRFLLFLLYMTLSVFATGHQHTHSKHSHLHSPHHSHKRASNSSSHDGSSLDEARKLLA
AGQAAMAHANRAIIANPRPNRLEVLNATELAKAQEPPPPLDYRNVTASSLKARDSGNGTA
KDLRYSVPDELIKAARLLSENWKPSPKDLDGGYAADVQHLKDDFMIKVNDTNMMPPMLQY
DSGLIKHVEEPPSAFRYSANESDIAEPAADKDESLGKRASTDWWMATISQRGSSPFAPSG
YQASDGIADDTDAINKAISSGGRCGGGKCTGSTIYPATVYFPPGTYKVSSSIIQYYNTEM
IGNPLDLPTILAAPSFVGLGVITSNVYTGETSQWYLNTNNFLRSVRNFIIDIRPTPADAQ
VCGVHWQVAQGTSLENIHFYMTKPKDDPKTTQQGIYMENGSGGFLSDLYFVGGKYGAYMG
NQQFTASGLYFEEAETAIQIHWDWGWTMQNIVVDNCKIGFTIVGGAGGIGSLHMTDLRMH
YVKVAVSTSIMSDNSTALLLSNSGFYYVDTIVEDTSKKQVLLPGGPKTINVDTWGFGRVT
SANGTTAFHNGAKLDSPVRDPSLVTGDRSQFFTRRRPKYDDLGFSQIIDAKGYGAKGDGK
TDDTAVLRHLFSAAANMSAVVYIPFGVYIITDTVEIPVGSRVIGQAWPQIMATGSKFSDA
LHPRVAVRVGLPGQVGVVEIQNMMMTVKGATAGAIMMEWNVHESGQGSVGLWDTHFRVGG
AAGTDLTVKDCPKLSGKVNKNCVAASLMLHMTPDSSGYFENVWMWTADHDFDTADQTQVD
IYVGRGMLVESKGPTWLWGTSVEHCVLYQYQLSGAQNVVMGLIQTEAPYFQSFPEAPAPF
TPGAFPDDPVFHDCTSKNSKSCAVAWALRIIDSSAVHVLSAGLYSFFSRYDQTCLKSGRH
DCQDKIFYAEQSYDVWVQNLVTLGSIEMVSPLNGVPTLGKPNRNGFASSILAWLGGSKNV
TGQRTFPGYKIHSEDTIGIDDFSEACQNALTALVRCDDATSGWTRASYHGILPVDPFWIS
GQLSIPTAVILSGQMALLLVSWVLLSHKVSTRHVKPTRKLERTITTSSSTLATLILLKRC
RIANFASPYSYYKRESFYQEALKAAVSRCSLSGQATTAKDSPFPSKSAKPAFYLSEVKHT
IQSGDTCDSLAIKYSISSVAIFIGNPNILDCNDIVQGLSIYLPLQYKTYKLRPDDSYMSV
SAAIDLKPADIRFLNPWIHKLCGNIRSAQETLGSVICITTPSGEFEYDVNNTSSDPAYSE
YTNKAIPPPKGATLAEKTTKEYRRWYIVQEGDNYAIVLVQHHISLRLFTAANPSVSQDKC
TTDLIPGKTYYVRPTTKAFSNQWDIPPH

Enzyme Prediction     

EC	3.2.1.58:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	214	953	3e-248	0.9918918918918919

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	5.70e-82	245	461	12	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.38e-08	587	655	1	73	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
212030	LysM	0.001	1139	1182	3	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
212030	LysM	0.004	1284	1332	1	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
197609	LysM	0.005	1138	1177	1	39	Lysin motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI68602.1|CBM50|GH55	0.0	1	1348	1	1380
QGI99492.1|CBM50|GH55	0.0	1	1348	1	1380
CCT72993.1|CBM50|GH55	0.0	1	1348	1	1380
QGI85803.1|CBM50|GH55	0.0	1	1348	1	1390
QKD46406.1|CBM50|GH55	0.0	66	1347	1	1282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.93e-174	219	954	2	753	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	1.37e-169	223	953	26	755	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	1.06e-164	221	950	41	870	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P49426|EXG1_COCCA	1.66e-147	223	930	48	761	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1
sp|P53626|E13B_TRIHA	4.47e-49	212	908	27	710	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001027	0.998944	CS pos: 18-19. Pr: 0.9671

TMHMM  Annotations     

There is no transmembrane helices in EEU38415.1.