CAZyme Information: EEU38044.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU38044.1
• CAZy Family: GH135
• CAZyme Description: glycoside hydrolase family 28

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	GG698919|CGC1	51666.26	7.9414

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698919:451971-453512(+)

Full Sequence      

MKLSIFVSALSLVTGALAGALELPAGVPRSVDEFREKHQYTPPSKRNHRKVFTIRASKND
HDDVSSEFYKGLKRANKGGTLHLTKGHTYVIGKPLDLTWLDNVHVHLDGEIKFTNDTAYW
QKNSFTHPFQNSIMFWKWGGKNIKIYGNGVLNGNGQRWWNEFAGKEILDKTNQYLRPILF
YAENATGLDIQGIHFKDSPCWTNFVVTSKDISFKDVVCTAHSNNATSLPKNTDFFDSLNV
EHLTVERAWVDIGDDCFSPKSNASDVYVNTMYCNGTHGQSIGSLGQYKGEKSFVKDVVIE
NVWMLNGQHGARLKTWAGPDVGYGFIDNVTFRNFWGGNNEYTAFIDSCYFNIDEATCAKY
PSQMNITNILFENFTGYSSGKYGDAIARLTCSSNPNAVCENIKFKNFDIKTPCGGKPVVI
CDGVSDIGMDCVSATSKEAKAALANKCTAPAASVSPFKVRKFHE

Enzyme Prediction     

EC	3.2.1.67:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	76	424	4.2e-62	0.9507692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	2.15e-33	141	424	54	315	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215426	PLN02793	5.96e-23	137	421	135	406	Probable polygalacturonase
177865	PLN02218	6.39e-23	63	428	82	424	polygalacturonase ADPG
178580	PLN03003	2.94e-21	145	456	117	414	Probable polygalacturonase At3g15720
215540	PLN03010	1.84e-20	80	436	82	407	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK94103.1|GH28	0.0	1	464	1	453
CEI39689.1|GH28	1.20e-298	1	462	1	462
CEF83238.1|GH28	2.05e-297	1	464	1	464
QPC64497.1|GH28	2.05e-297	1	464	1	464
CZS73452.1|GH28	2.05e-297	1	464	1	464

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C2L_A	7.92e-51	37	436	4	387	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]
1IA5_A	7.99e-17	92	315	35	238	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
1HG8_A	7.01e-16	62	318	1	249	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
1RMG_A	2.34e-07	254	421	197	350	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DAX2|PGXB_NEOFI	3.25e-166	13	440	19	440	Probable exopolygalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pgxB PE=3 SV=1
sp|Q0C7H7|PGXB_ASPTN	1.07e-162	4	436	7	435	Probable exopolygalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgxB PE=3 SV=1
sp|Q2TW03|PGXB_ASPOR	8.71e-162	4	431	7	430	Probable exopolygalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pgxB PE=3 SV=2
sp|B8NX60|PGXB_ASPFN	1.24e-161	4	431	7	430	Probable exopolygalacturonase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgxB PE=3 SV=1
sp|Q873X6|PGXB_EMENI	1.69e-160	49	433	55	438	Probable exopolygalacturonase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgxB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000526	0.999435	CS pos: 18-19. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in EEU38044.1.