CAZyme Information: EEU37841.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU37841.1
• CAZy Family: GH13
• CAZyme Description: Oxidoreductase [Source:UniProtKB/TrEMBL;Acc:C7ZDK3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	GG698920|CGC6	50158.98	6.2661

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698920:579747-581072(+)

Full Sequence      

MSPSSTITRYVIVGMGVRSSMYYESIIRDFKDVAKLVGICDTNQTRMNAANDHIAELGGE
RVPTYKDTDFDKMVQEQKADVVIVTTIDLFHHHYCIRAMELGCDAITEKPMTIDEEKLQA
MIDAEKKTGKQVRVLFNYRYAPHHTKVRELIDSGVIGEISTVHMDWILDCPHGADFMRRW
HRHKETSGGIQMHKSIHHFDLVHFWLDTEPELVYCLGSLRFYGKENAEKRGEKNLGERYL
NNQDAKQDPFAFQLGDNERMKKLYLDAEHEDGYIRDRNCFGEDITIEDNLSMIIKYKNRA
VLTYNTYAYAPWEGYRCVFNGTKGRLEINVVESGYSPTGIPVSKDPSGEDKQYIQGGVEQ
TKIVVYPMFDEPYVVDVVKQEGTHGGGDPILLRDVLLGEKKGGVDRAAFIRDGGNAVLVG
VGANHSMKSGMPVKVQELVRW

Enzyme Prediction     

No EC number prediction in EEU37841.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	9	171	7.4e-28	0.40601503759398494

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223745	MviM	6.36e-42	9	224	5	213	Predicted dehydrogenase [General function prediction only].
397161	GFO_IDH_MocA_C	8.26e-21	148	435	1	204	Oxidoreductase family, C-terminal alpha/beta domain. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
396129	GFO_IDH_MocA	2.18e-17	9	136	2	120	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
182305	PRK10206	1.31e-05	60	166	42	154	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYV32364.1|CE9	6.54e-25	9	437	396	753
AHF92902.1|GH0	3.01e-15	3	430	13	393
UPK44969.1|GH0	1.14e-14	39	286	33	268
AVT49031.1|GH109	5.99e-11	2	427	49	431
VEF25502.1|GH109	5.99e-11	2	427	49	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3EZY_A	7.12e-12	9	219	4	198	Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_B Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_C Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_D Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima]
4HKT_A	1.17e-11	34	213	28	191	Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_B Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_C Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021],4HKT_D Crystal structure of a putative myo-inositol dehydrogenase from Sinorhizobium meliloti 1021 (Target PSI-012312) [Sinorhizobium meliloti 1021]
3Q2K_A	1.47e-11	9	214	32	227	Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_B Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_C Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_D Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_E Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_F Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_G Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_H Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_I Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_J Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_K Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_L Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_M Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_N Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_O Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I],3Q2K_P Crystal structure of the WlbA dehydrogenase from Bordetella pertussis in complex with NADH and UDP-GlcNAcA [Bordetella pertussis Tohama I]
3MOI_A	2.83e-11	9	202	4	186	The crystal structure of the putative dehydrogenase from Bordetella bronchiseptica RB50 [Bordetella bronchiseptica]
1EVJ_A	1.01e-10	55	210	46	201	Chain A, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_B Chain B, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_C Chain C, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_D Chain D, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34371|YTET_BACSU	1.59e-75	11	438	5	422	Putative oxidoreductase YteT OS=Bacillus subtilis (strain 168) OX=224308 GN=yteT PE=2 SV=1
sp|A3D6B7|GH109_SHEB5	1.06e-11	2	427	49	431	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) OX=325240 GN=Sbal_2793 PE=3 SV=1
sp|A6WQ58|GH109_SHEB8	1.88e-11	2	427	49	431	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS185) OX=402882 GN=Shew185_2813 PE=3 SV=1
sp|O68965|MI2D_RHIME	2.49e-11	34	213	27	190	Inositol 2-dehydrogenase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=idhA PE=1 SV=2
sp|A9KUT1|GH109_SHEB9	3.33e-11	2	427	49	431	Glycosyl hydrolase family 109 protein OS=Shewanella baltica (strain OS195) OX=399599 GN=Sbal195_2933 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EEU37841.1.