CAZyme Information: EEU37082.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU37082.1
• CAZy Family: GH1
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:C7ZG34]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
788	GG698924|CGC2	86714.85	5.3819

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698924:110218-112685(-)

Full Sequence      

LQLLTLEEKVSLLAGADTWHTNEISRLGIGSLKTTDGPSGARGQLAVDGPTAAFLPGPIC
QAATWSKQQLRSVGQLLCEETRTKAAQILLAPTICLSRNPLGGRNFESFGEDPFLTGSLA
TEYVAGVQETGQVMATVKHFVANEQEWQRFTIDAKVSEKALREMYLKPFEMVVRSNTTPG
CLMTSYNVVNGAHADMNQHLLQDVLRGDWGFKGLVMSDWGGTNSTAESVIAGLDLEMPGP
PSKRGELLLEAVNKAENPDELLKAIDASAGQILSMCKRMSLLGLSEEEALQTRKHLEQSS
TTQEGIKLMRTVAAQGAVLLKNDKSTLPLKPSGLSGKQVAFIGPNALVGTPGGGGSATMN
PQYLSQPMSSFKAAVEAQGLNTRVVYSQGAYSKKWLPHFKKEQWKSRTSGEDGKNLVRVD
FYTTRDLSGPILETQHRNSSWVDFVDSAPLPLQKAHVPPYSFRVTSTVRPETTGNHRFGV
ASVGEARLFIDGGLVLENCNWTETSEAFFSFGSREKISSKHMNAGQTYDLVLEGWTKPGL
SEEESLHFFAGHPSVRIGFEEELPKNMIDTAVKTADESDYSVVILGIDDEWESEGYDRQF
MELPGTQNELAEALLTRCKHPERLIFINQSGSPVELPWEEKCSTLVQAWYGGQEAGNGLA
DLLLGAINPSGRMPISWPRKYTDLPYAADKEMWPGVDGTVIYKEECHLGYRYYLHNNVRP
HFWFGYGLSYTQFESSVQLEGKNPDSWTFSTTVKNVGSADGEETVQLYAWPSGKEAKRRL
VAFDKTPL

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	22	238	2e-61	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.44e-56	23	358	54	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	6.96e-52	56	768	121	690	beta-glucosidase BglX.
178629	PLN03080	8.14e-43	3	785	59	727	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	6.93e-40	552	730	65	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.07e-35	23	275	60	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95903.1|GH3	0.0	1	788	13	800
CEI68113.1|GH3	0.0	4	788	14	810
UPX44937.1|GH3	0.0	2	788	11	805
EGX50909.1|GH3	9.84e-195	4	785	27	774
CZS83428.1|GH3	1.13e-193	1	788	38	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.34e-137	4	788	13	782	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.58e-131	4	788	13	782	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.42e-87	4	785	12	612	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
4I3G_A	1.97e-80	4	788	61	775	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
2X40_A	3.91e-72	1	788	8	661	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	1.69e-156	1	788	15	785	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|B8NDE2|BGLI_ASPFN	6.89e-150	4	778	13	764	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|Q2U8Y5|BGLI_ASPOR	9.69e-150	4	778	13	764	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.03e-148	4	771	13	756	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.03e-148	4	771	13	756	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.994737	0.005301

TMHMM  Annotations     

There is no transmembrane helices in EEU37082.1.