CAZyme Information: EEU37048.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU37048.1
• CAZy Family: PL3
• CAZyme Description: UDP-Glycosyltransferase/glycogen phosphorylase [Source:UniProtKB/TrEMBL;Acc:C7ZFW6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
494	GG698924|CGC3	54753.28	6.7750

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698924:410831-412473(+)

Full Sequence      

MTTPVIDTRKVLMLTNIEHGQSNVFLAAAQAILEADPSVEVHFATFRGLEGSVAEVSEYA
RGSTPGVRPIVYHEIQGLSYRQGLQNYTERHNIPARPGYFADSVSTPLSFSATKQAIRDF
LPAFIPYTGEELGEIVASIIGIIKDVNADLVVLDPLMTAGLTTVWHLQVKYMVLSPNTIK
DFAAAGQPRGEKFWKYPALFTGYSYPVPWHLIPLNVYFLFYMAYLWITSRHRKETTTHLK
DKLGIDLKTAIDLQRSTPESPKIAVGFLPELDFEGILPNNILPCGPILRSALPIEESDPE
LGKWLAKGPTVYINLGSMCQIDEQQMIEMASAIKATIDRFQTSCKRPLQVLWKLKTHKGI
NTQNAKIVDILGKDIVADQVRIVDWVVSEPIAILRTGHVICSVHHGGANSFNEAVRVEML
GVGRLGSKNTKPRWTAKGLGQSLIDVIMGKDYEAMKKRAEDLARLCKDAGEGREVAAKFI
LEEMAAEDDLPVSV

Enzyme Prediction     

No EC number prediction in EEU37048.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.47e-22	10	464	2	390	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
215127	PLN02210	5.98e-05	281	472	225	415	UDP-glucosyl transferase
224732	YjiC	7.74e-05	10	487	3	401	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
177830	PLN02173	2.50e-04	304	444	257	374	UDP-glucosyl transferase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95219.1|GT1	4.46e-292	1	493	1	516
UJO17776.1|GT1	5.02e-165	9	483	7	499
QYS93006.1|GT1	8.86e-134	9	483	7	487
UKZ74408.1|GT1	2.76e-129	9	483	7	486
UKZ47850.1|GT1	3.22e-129	9	483	7	480

PDB Hits     

EEU37048.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A1B4XBH6|SDNJ_SORAA	1.74e-43	11	428	8	434	Glycosyltransferase sdnJ OS=Sordaria araneosa OX=573841 GN=sdnJ PE=1 SV=1
sp|A0A411KZY6|BUAB_ASPBU	1.46e-40	11	486	8	490	Glycosyltransferase buaB OS=Aspergillus burnettii OX=2508778 GN=buaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

Start	End
205	227