CAZyme Information: EEU36967.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU36967.1
• CAZy Family: CE8|CE8|CE8|CE8|CE8
• CAZyme Description: carbohydrate esterase family 8

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329		35070.92	9.2853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698924:14339-15381(+)

Full Sequence      

MKFLATLNFVTAAFAASRTSAPSGCLTVKKSPSSGQYGTIQAAVNALSTSASGSQCIFID
QGTYNEQVLVPKRSAQLTIYGYTADTSSYSGNKVTITAKKSQADGLNNDESATLRVKSSN
FKLYNVNVANTYGKGSQAVALSAYADSGYYGCALTGYQDTLLSNEGYQLYSKCLIQGATD
FIFGQKASSWFEKCDLRVVSASIGYITANGRDSSSNPSYYVFNNCNIAAASGNSVTNGAY
YLGRPWREYARVVFQKTSMTSVINAAGWKVWNSGDERTGNVIFGEYSNTGAGASGKRASF
YTKLSSAVSISTVLTGSYASKGYYDASYM

Enzyme Prediction     

No EC number prediction in EEU36967.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	306	3.1e-82	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	3.63e-53	15	307	2	275	putative pectinesterase
395871	Pectinesterase	4.25e-52	34	297	9	271	Pectinesterase.
215367	PLN02682	3.60e-50	15	305	60	348	pectinesterase family protein
215357	PLN02665	2.63e-47	27	305	69	341	pectinesterase family protein
178372	PLN02773	4.91e-47	20	293	1	270	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95258.1|CE8	1.13e-205	1	329	1	309
QKD62636.1|CE8	2.80e-197	1	329	1	329
QGI88211.1|CE8	3.26e-196	1	329	1	329
QGJ01763.1|CE8	3.26e-196	1	329	1	329
CCT75603.1|CE8	3.26e-196	1	329	1	329

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	1.17e-78	17	314	2	287	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.17e-78	17	314	2	287	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.35e-35	34	293	16	273	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	3.92e-30	35	293	13	269	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	6.94e-14	28	293	8	311	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	5.75e-102	4	329	6	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	1.07e-99	4	328	6	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.54e-80	18	328	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.54e-80	18	328	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	4.07e-79	18	314	28	312	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999676	CS pos: 15-16. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in EEU36967.1.