CAZyme Information: EEU36943.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU36943.1
• CAZy Family: CE8
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:C7ZGN3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1530	GG698925|CGC2	169466.35	4.6197

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698925:351747-357261(-)

Full Sequence      

MTNSLGHQRLSLLNLFVLFSFLLHSSLVLSYAHSHAKHDHLHHLHGQSLRAATLATTKAT
STGQDDFTCGPDKPCSNEACCGEDGWCGYGPNYCGDGCQSNCDAKAECGQFAATAGKTCP
LNVCCSQHGFCGTTADFCNDGCQSNCDSPKPNAAASDPQKVVIGYWETWNMDKPCGTMGP
GEIPVELLTHLFVSFGYINADFQVTNMDGIDPAIYKTIGNVKARNPNLKIVIALGGWTFS
DPGPWQDKFPSLASTKENRATFINNLLGFLSEYGYDGVDWEYPGADDRGGADGDGANYVA
LMKELREAINSRGRDYIVTFTAPSSYWYLRHFDLKGMETYVDWINLMSYDLHGVWDSDNP
IGNQVLSHTNLTEIDYALDLFWRVGVEPSSIVLGLGFYGRSFELESASCWKPGCAFKGPG
SPGRCSNTAGILSYAASSYHNSWGIEIMEILDKTGGTPYFDETAASRYMVYDGHSWISFD
DAETFQMKIDYASKMGLHGLMIWAIDLDTPNLEALRSISNGELIGATKTPFSLVDLERIF
PAEMLPPDDAEKDYALINFGSNANAGEIDPNQTGFGFVLITGDSAAVSSLKKREDEPEPL
VFLDCPADVLEQPENETRVARVVCLSENVEGCFRVMERGVEGTIVEMPDNLHAQCAPNSL
ARAISLTESKDQSLPSTQSRRAVTSKVFDFAFDMNLNKTRRDTGDLKVRVDYSNVGGYWN
AAVDSLGIQADDSLQRRIAKRFFAESQADWRTMYQDAEVHKSDGERFVNEEIDTPLFWDT
TQDCEFEGEDYELGFGAHVGGKIKADFTYGFSMIAELSNILNVRQANGWLNVDGESDLNF
SIGGVGEVDFDLAKKGNPTSTENKPVKLKGHTLHPSGNSRLSFQPYYKIDYTLGSFNNTD
GEAGSDSAPYFDGKLSTRIKSDFGGFNMNFPPNPSDKLGTRNVDRESNRISMGNDNIIYN
SGGAGGRFALGAFLSFGVKIDLGLFKDRRHLNIPIIDMSMDYRTVTEWSFFPSPDFTPET
CLNTSVVTIALQNYEMDDDKTIGWSESEALPYIVSDSQRKGGDSSCYQDQPSLGADMAWG
YGSDSNINPLTYMDEEAAKAIEGSDEELSCPTCLVCGKNRKTGTPCCGCANMDLELGDTD
IPDYKSYRPEVDTGGPWPWPGYQSTSSLSRRGQPDPMDGQQWSRLESRIDGQATMTGKKV
LICPRGKNDNGRKLALYGKTYGYPSFPKNALHQWEGIEGNKWDDISRYWGNTSMSCSDWE
VDALRPHDTAWIRGANGKLEEVRAKYETEHVFEGQLIGDFFTEWLNKGKIVNQRPTPQNP
TPKVPCAWTEQWILREDDSYPWRLDGDQRAFIYLLLAELGNASHLDRLTIFKARPNGMKG
SMFGGKQSSALSAYTKMSAEQKLLATKEMGMVFEYMNNPIIWKKFCDTYEALYELFGEFD
TFYAQHGTGSTIPSLQKEWKEFMEVVLTSLVARSKAAFEIHTIIAFGGIFTFDPSMLVHG
IHWVKNIAVNQPKIRIDGTCPNLGPTDNGA

Enzyme Prediction     

No EC number prediction in EEU36943.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	159	516	3.7e-68	0.9662162162162162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	9.07e-83	161	508	1	334	Glyco_18 domain.
119357	GH18_zymocin_alpha	2.00e-75	163	508	3	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
119351	GH18_chitolectin_chitotriosidase	6.62e-70	162	508	1	341	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
395573	Glyco_hydro_18	1.63e-68	161	508	1	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.67e-66	162	508	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95469.1|CBM18|GH18	0.0	1	1530	1	1499
UKZ58390.1|CBM18|GH18	0.0	54	1479	76	1529
UKZ58865.1|CBM18|GH18	0.0	61	1526	81	1572
CCT76082.1|CBM18|GH18	0.0	59	1523	53	1527
QGJ02191.1|CBM18|GH18	0.0	59	1523	53	1518

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	4.04e-46	160	508	4	350	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6JM8_A	4.59e-45	160	508	4	350	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
5WUP_A	2.31e-44	162	528	95	458	Crystal structure of a insect group III chitinase (CAD1) from Ostrinia furnacalis [Ostrinia furnacalis],5WV9_A Crystal structure of a insect group III chitinase complex with (GlcNAc)6 (CAD1-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WUS_A	2.71e-44	162	632	4	449	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
1HKK_A	6.50e-44	180	508	22	342	High resoultion crystal structure of human chitinase in complex with allosamidin [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q95M17|CHIA_BOVIN	1.96e-42	162	508	24	365	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
sp|Q6RY07|CHIA_RAT	2.70e-42	162	508	24	365	Acidic mammalian chitinase OS=Rattus norvegicus OX=10116 GN=Chia PE=2 SV=1
sp|Q13231|CHIT1_HUMAN	4.29e-42	180	508	43	363	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q8SPQ0|CH3L1_CAPHI	4.42e-42	162	508	24	357	Chitinase-3-like protein 1 OS=Capra hircus OX=9925 GN=CHI3L1 PE=1 SV=1
sp|Q91XA9|CHIA_MOUSE	4.92e-42	162	508	24	365	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000543	0.999425	CS pos: 30-31. Pr: 0.9689

TMHMM  Annotations     

Start	End
12	34