CAZyme Information: EEU36671.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU36671.1
• CAZy Family: CE4
• CAZyme Description: Glycosyltransferase family 32 protein [Source:UniProtKB/TrEMBL;Acc:C7ZH53]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	GG698927|CGC3	41688.91	5.3772

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698927:34263-35418(-)

Full Sequence      

MANVDADDSYDEERLDWGKSVGGSTSRWSAWPRKVLRLPRPRKYAALLLLTDVIIVSLVV
LLFEPLITLLLRNEELFGARLTFPLDTAPSASPKPTQQPQTIPRIFHQTIATDVIPEKWI
HSQQTCKEAYKDFEYKLWTDEIARNFIEAEYSWFLDTWDEYTFPIQRADAIRYFVLYHYG
GIYLDMDTNCNHTIPFEQLEADGETHHAVFKSTTPTGVSNDLMISSAGHPVLLATISKLL
YYNDITRPWAKLLPHAAIMIGSGPFFLSMIIKNWLLDQPSLPTPAIQVINATELEPYITD
LEGCSWHHGDTKTLMWVGDRPWIWFSLGAIGLVLGLNVINYLLLQTTKGVTKLVSVTDEM
KNTKLT

Enzyme Prediction     

No EC number prediction in EEU36671.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	118	194	2.9e-22	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.80e-45	83	344	63	314	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	3.80e-21	116	195	1	84	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95791.1|GT32	3.97e-266	1	366	20	385
QKD62461.1|GT32	1.34e-151	9	345	14	339
CEI62385.1|GT32	2.29e-148	2	345	10	341
QGI70654.1|GT32	9.66e-147	9	345	14	339
QGJ01544.1|GT32	9.66e-147	9	345	14	339

PDB Hits     

EEU36671.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	4.54e-48	99	312	59	265	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	2.81e-47	86	314	43	259	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	2.75e-44	82	316	67	291	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	6.97e-44	96	328	51	276	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.20e-35	100	320	62	274	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999973	0.000011

TMHMM  Annotations     

Start	End
44	63
252	271
322	344