CAZyme Information: EEU36342.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU36342.1
• CAZy Family: CE12
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:C7ZHU6]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
840	GG698929|CGC4	91747.06	6.0169

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698929:3807-6482(-)

Full Sequence      

MASADIDTTLANLSLEEKISLLAGGDVWLTVPIPDKGIPCAKTTDGPNGARGSKIKDGKS
AACFPAACSVASTFDVDIARRIGVALGEETLTKGARCLLAPTVCIHRHPLGGRNFESFSE
DPFLTGQMGIANVIGLQSTDVSATVKHFAVNEQETQRLNVNAVIAERPLHEIYLKPFELI
IKNAKPWAIMTAYNKINGHHADSNEYLLKKVLRGDWGWTDGLVMSDWGGVNSTAESINAG
VDLEMPGPARWRKPEVVLEAIKQGKLTGETITERVRNVLSFLKRLNAFENPIWSDPEEHA
IVNPQHSALIREAGAKGIVLLKNDNNCLPLARERMQGKKIALLGYAKECLAHGGGSASVK
PHYRVTPWDAFHEAFKGQDVEFVYSKGAHTFRQLPLLIDHVLDLERNPGFTYHIYEPGTS
TPTKTIHGYDKSETSLLDGHILHNVEIDLIGTFHPPESTNYYLTLASLGPSQLFINDELI
LEQKANCPDAMGFLFGGVPVPKVCVPMEAGKKYTIRVHASPPVPDGDKDLGFLEGQVGVR
LGYMSSTEHDADILSEAVDLAKSSDYSIIFTGNDPAWETEGQDQASFHLPKEGSQDHLVS
TIAAVCPNTVVVNSTGVAVAFPWLHQVQGLLQTWFPGQEAGNSIVDVLTGVQNPEGHLTC
TFPKRLPDCPAYGNFPGEKHSTHGLEVKYEEGVFVGYRHFDRLPADAVNFPFGFGLSYTT
FDFEGFTVRKQSEDVFAVQLRVRNTGAVKGATAVQIYVGSKNPSPSDPIKVLAGLKKVTL
EPESSTTVKIIVQVRDFAFWDEETHGWVVKAGEYQFSVGRSSTELVATSMVQLERKTFAP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	34	246	5.5e-62	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.33e-63	37	345	59	362	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	3.86e-61	64	822	120	754	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	5.68e-44	318	697	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	2.04e-38	37	280	65	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.98e-38	13	792	60	742	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95485.1|GH3	0.0	1	840	1	816
CEF72767.1|GH3	0.0	1	840	1	834
CZS76034.1|GH3	0.0	1	840	1	834
QPC75250.1|GH3	0.0	1	840	1	834
CEI64461.1|GH3	0.0	1	840	1	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.81e-171	1	838	1	841	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.38e-166	5	838	5	841	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	5.09e-122	3	833	2	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	9.61e-115	12	834	11	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.42e-107	6	836	4	718	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.41e-309	4	840	9	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q5BA18|BGLK_EMENI	2.73e-179	5	837	12	833	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DFA8|BGLI_NEOFI	1.47e-175	1	829	1	826	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	8.20e-175	1	838	1	834	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	6.44e-174	1	829	1	826	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.964262	0.035745

TMHMM  Annotations     

There is no transmembrane helices in EEU36342.1.