CAZyme Information: EEU36340.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU36340.1
• CAZy Family: CE12
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7ZI73]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
577	GG698929|CGC3	63531.64	6.5065

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698929:378317-380097(+)

Full Sequence      

MATSKQQYDFIVVGAGPAGCSVARGLAHATTRPSVLLVEAGGENSDVNHRVMGNLFVQMM
EPTLANPYKSSPQEHLAGREIDLMRGKGLGGSSTVNFTTWTTGPRDDWDTMAEITGDSAW
SWANAKERFKKLETYHDKVPEVPDGVKKYLDPKSDDHGYQGPLHVGFEDKWDSYATSSID
IWKANGYDISTDTGNGECLGISVAPKTMYRGTRATAADLLYPTPGNLHIKTDSPVHRIIF
EDKKAVGISLLDGTILRATKEIIFSAGSLDTPKILMHSGIGPRDQLERFGIQQILENPNV
GQNYKDHYHVALKFGRAEHTDNITAFFRSKALQDAAKREWELYRTGPYVTAGTSMNMGFF
KSDAVLQSKEFEDLPAGEKKRLQRPTIPTYEIATAGIAQEYYTDPHTVPPLLPIMVFVHN
SQGVGNVQLASADPAKPLIFNPSFASHPYDKRVIIEATKEVMKVSRSPEFQKDAHPTQAN
FDVPASDSDEDILDFWRRNCTSTWHMSGTCSMGRSEKDGAVVDTGFRVFGVSGLRIADLS
VMPIIASCHTQSTAYQVGMLAAEKIVAEYSLNGRARL

Enzyme Prediction     

No EC number prediction in EEU36340.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	6	567	2e-141	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	3.16e-77	3	565	1	527	choline dehydrogenase; Validated
225186	BetA	8.99e-73	1	568	1	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	4.47e-34	424	565	4	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	4.69e-30	8	568	56	579	Protein HOTHEAD
366272	GMC_oxred_N	4.73e-22	78	308	16	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95388.1|AA3_2	0.0	1	577	1	577
QBZ66107.1|AA3_2	5.43e-204	1	577	1	584
AEO58638.1|AA3_2	1.81e-163	7	571	4	563
UPL00845.1|AA3_2	7.48e-163	1	571	1	564
QSS70419.1|AA3_2	2.33e-161	8	571	5	563

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3Q9T_A	1.72e-50	2	569	1	573	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	2.37e-50	2	569	1	573	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	3.27e-50	2	569	1	573	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
4H7U_A	2.04e-47	4	570	37	602	Crystal structure of pyranose dehydrogenase from Agaricus meleagris, wildtype [Leucoagaricus meleagris]
3FIM_B	4.20e-43	8	568	3	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q3L243|PDH2_LEUMG	1.13e-53	4	570	37	600	Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris OX=201219 GN=pdh2 PE=2 SV=1
sp|Q3L1D1|PDH1_AGABI	9.78e-53	8	570	41	594	Pyranose dehydrogenase OS=Agaricus bisporus OX=5341 GN=pdh1 PE=1 SV=1
sp|V5NC32|PDH1_AGAXA	2.06e-52	4	569	37	599	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1
sp|A6X2G7|BETA_BRUA4	3.13e-52	9	571	4	531	Oxygen-dependent choline dehydrogenase OS=Brucella anthropi (strain ATCC 49188 / DSM 6882 / CCUG 24695 / JCM 21032 / LMG 3331 / NBRC 15819 / NCTC 12168 / Alc 37) OX=439375 GN=betA PE=3 SV=1
sp|Q0R4L2|PDH3_LEUMG	7.46e-52	4	570	37	600	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000006

TMHMM  Annotations     

There is no transmembrane helices in EEU36340.1.