CAZyme Information: EEU36298.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU36298.1
• CAZy Family: CBM67|GH78
• CAZyme Description: Mannan endo-1,6-alpha-mannosidase [Source:UniProtKB/TrEMBL;Acc:C7ZHY5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		48494.45	4.4911

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698929:118933-120406(+)

Full Sequence      

MLALHTQAAGLLLLAHLLPVHSLEIGSRDDILKTSKSLAADLIKFYHGNETGQVPGLLPE
TTIKTKDDDVTYYFYQSGAFMSTYIDYWQLTGDETYNDLVVQGILHQVGQNEDFIPANQS
LNAANDDQSIWAMAALTAAEYGFPDPPEDEPQWLDLAESVFESQRLRWDREVENKTCDGG
LRWQIAFINNGYDWKSAEANTFFFALSSRLARQTGNKTYVEYAEKLWDWLYDIELIDHDT
FAVYDGSSVKSNCTQISKVQRSGAASSLALGAAYMYNQTDGSSTWKSRVEKLTSSFIDTF
FQKGGSFAEASCPTEKKCPRDLLTFKALSQRWLAVTSQIAPFTAEIILKALRKSAEESDA
DKDGDDALEQTMGELAVVSNLLISDAHAAVSWGDEKTNSSGSGSALLRVLRGLTWFWPCL
LGLCTLCKPLPPVLKSL

Enzyme Prediction     

No EC number prediction in EEU36298.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	33	366	2.6e-67	0.8379888268156425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	6.93e-119	35	356	6	311	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95575.1|GH76	3.12e-269	1	402	1	402
QKD60681.1|GH76	1.07e-148	7	388	6	388
QGI87419.1|GH76	1.11e-147	7	388	6	388
QGI70057.1|GH76	2.24e-147	7	388	6	388
QGJ00947.1|GH76	2.24e-147	7	388	6	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.66e-104	24	405	29	432	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P36091|DCW1_YEAST	4.13e-77	23	355	24	340	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	1.16e-75	14	355	10	337	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q75DG6|DCW1_ASHGO	1.13e-73	6	364	7	351	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2
sp|O74556|YCZ2_SCHPO	5.68e-67	37	355	35	337	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q05031|DFG5_YEAST	8.50e-67	23	411	29	425	Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DFG5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000294	0.999658	CS pos: 22-23. Pr: 0.9750

TMHMM  Annotations     

There is no transmembrane helices in EEU36298.1.