CAZyme Information: EEU36069.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU36069.1
• CAZy Family: CBM21
• CAZyme Description: polysaccharide lyase family 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		24328.19	5.0271

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698931:154228-155018(+)

Full Sequence      

MHSASLVSLIAALPAAMACLGYEGGLPTPTDSKSLSAPQYIKAGQTFDAGWVKYDRGQSC
SGQSEGGEADTVFVLEEGATLRNVIIGKNQKEGVYCLGSCNLEFVWFEDVCEDAISIKGD
GTANIIGGGAYKASDKVIQHNGCGHVNIVNFYANDYGKVYRSCGNCKNNCARSVHMEGTT
AVNGGELIGINTNLGDKATYSNNCYPKVQCQGYNGCDKANGDCEPTKAALC

Enzyme Prediction     

EC	4.2.2.2:5

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	30	215	1.4e-81	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	2.85e-120	23	220	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99996.1|PL3_2	3.06e-168	1	231	1	231
QKD53642.1|PL3_2	4.07e-148	1	231	1	231
CCT64935.1|PL3_2	1.17e-147	1	231	1	231
QGI78430.1|PL3_2	1.86e-147	1	231	14	244
QKD61417.1|PL3_2	2.08e-146	1	231	1	233

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	3.08e-28	41	164	11	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	6.25e-22	41	165	16	139	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	6.39e-22	41	165	17	140	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z03_A	5.71e-21	41	165	25	148	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]
4Z05_A	5.71e-21	41	165	25	148	C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725],4Z05_B C. bescii Family 3 pectate lyase mutant E84A [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B024|PLYF_EMENI	9.59e-99	13	231	12	231	Probable pectate lyase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyF PE=3 SV=2
sp|B0Y953|PLYF_ASPFC	9.40e-97	13	231	12	232	Probable pectate lyase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyF PE=3 SV=1
sp|A1D5E3|PLYF_NEOFI	7.67e-96	5	231	4	232	Probable pectate lyase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyF PE=3 SV=1
sp|B8NJZ7|PLYF_ASPFN	3.11e-95	9	231	8	232	Probable pectate lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyF PE=3 SV=2
sp|Q4WKV8|PLYF_ASPFU	3.11e-95	13	231	12	232	Probable pectate lyase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.002756	0.997227	CS pos: 18-19. Pr: 0.9078

TMHMM  Annotations     

There is no transmembrane helices in EEU36069.1.