CAZyme Information: EEU36021.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU36021.1
• CAZy Family: AA9
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7ZJ64]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
578		63776.60	6.1476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698932:234420-236156(-)

Full Sequence      

MVKNGSHFDFVVVGGGTAGNVVAGRLAENPNVSILIVEAGIANPQDVHEITTPSSAMSLR
GSKHDWAYKTTMVKRDDYERIEKPNTRGKALGGSSSLNYFTWIPGCKPTFDMWEEYGGKE
WTWDPLVPYLRKSATYHDDLGLYPKDLQKLGKGGPLPISHAELLDDLQPFRDLLTEAWKD
RGGTLTENIYDGEMIGLTHCVDTIYKGQRSGSFLFVKNKPNITILAEVHSKKLIIDEASR
ECKGVTVIDSSGAELSFYATREVILSQGVFESPKLLMLSGIGPKNELSKHGITTLVDSRH
VGQNLLDHPGVPFVLKVKDGYGMDDHLLRAGPKHDGAVSAFSKGHAGPMGSGLLEMVGFP
RIDNYLEKDAQYRERKAANGGKDPFCPDGQPHFELDFVAMFGSAFQWHYPTPKSGCHLSV
VVDLVRPVSDPGEVTLNSADPLVQPNINLNFFADDLDIIAMREGIRFSYDVLTKGKGFKD
IVLAEYPWEMPLDNDEEMHHAVLDRCQTAFHPCGTARLSKNIDQGVVSPELKVHGISKLR
VIDASVIPVIPDCRIQNSVYMVGEKGADMIKAEHKDLY

Enzyme Prediction     

No EC number prediction in EEU36021.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	7	572	2.3e-143	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	1.64e-79	5	575	5	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	2.71e-78	7	571	5	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	3.08e-37	427	565	1	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	1.80e-20	4	563	50	569	Protein HOTHEAD
366272	GMC_oxred_N	1.91e-19	87	309	23	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02484.1|AA3_2	0.0	1	578	1	578
BCR85434.1|AA3_2	0.0	1	578	1	578
UDD59638.1|AA3_2	0.0	1	578	1	578
QMW42855.1|AA3_2	0.0	1	578	1	578
QRD89697.1|AA3_2	0.0	1	578	1	571

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5ZU2_A	0.0	4	578	3	577	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	0.0	4	578	3	577	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
3Q9T_A	0.0	4	578	3	577	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5OC1_A	1.12e-70	8	573	2	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.36e-70	6	573	1	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0R4L2|PDH3_LEUMG	1.35e-61	8	570	41	595	Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris OX=201219 GN=pdh3 PE=2 SV=1
sp|Q988C9|4PADH_RHILO	3.11e-61	2	570	1	533	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	9.76e-61	4	570	43	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|M5EAX2|GMCH_MALS4	9.76e-61	4	570	43	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|V5NC32|PDH1_AGAXA	1.35e-60	7	574	40	599	Pyranose dehydrogenase OS=Agaricus xanthodermus OX=83518 GN=pdh1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000007

TMHMM  Annotations     

There is no transmembrane helices in EEU36021.1.