CAZyme Information: EEU35660.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU35660.1
• CAZy Family: AA7
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:C7ZJV7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
850	GG698936|CGC1	92847.03	5.1467

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698936:85208-87975(+)

Full Sequence      

MAQQPTDAELLELLSQLTTSEKISLLAGKNSWETQNIDRLNIPSLKVSDGPNGARGADFL
DGRTAACFPACVSLAATFNRKLARQIGVALAQETQTKGAYVLLGPTVCPHRSPLGGRNFE
SLSEDPLLAGELASEYVLGLQSERVGATVKHYAINEQDTRRFTVNETVSDRAMREIYLRP
FEIIIKKSDPWCIMTSYPKVNGHYVDDQTTLLKDILRDEWGYKGLTMTDWGAASAAVDAG
IRNGLDLEMPGPPHRRKGDVVQKLVDDGKVHLKDIDEHVLNILKLLRQTGKFTDRREPVP
EYSVSRPEHERLIREAGAEGMVVLKNAGKALPLKPPSLKNIAVLGPLAKQTAAHGGGSAS
LNCHYKVSPFDAITSRLGDSKVSYSKGAHVFRTYPDFTLGAVNRNGNPGFICDFFKTLDM
SDEAVHTSEYPRGSFMSIMNAEIDDAKAVRMTTAYTPSVSGKHYLSFSGMGPTKLFINRV
FLGEIKETEEAMMFFLGAQEEKHVQYDFIAGQKYDILVESTISPVPNAELFLAEDKLAVH
LGFIEQAEMEADLLSEAVELAKQADVALVFVGNTPQWETEGQDMATMSLPANGSQDKLIA
EVAKVNSNTIVVIGTGVPVELPWLDEVAAVVQTWYGGQETGNAVLDVLLGEVNPSGKLPA
SWPKKIEHTACYGHFGLDSWESREVEYVEGVNVGYRHFDSQYGTEKEVLFPFGFGLSYST
FEISGSALSGTLSEGDANAEVIITALVHNTGDRAGSEVVQVYLAPPKGDEDKGRPPKALV
AFDKVHLAPGEKKELQLSFKRDGAAFWSEKDKLWKVEGGDHGVYVSTSSSPLDVKSTHTL
NVPQAFNFGP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	36	250	2.7e-60	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.17e-71	1	838	29	761	beta-glucosidase BglX.
224389	BglX	2.73e-61	39	390	57	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.71e-51	321	718	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.68e-47	5	798	48	741	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.94e-29	39	285	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02780.1|GH3	0.0	1	849	1	827
EAA65189.1|GH3|3.2.1.21	1.52e-250	8	828	9	826
ABF50843.1|GH3|3.2.1.21	1.52e-250	8	828	9	826
BCS18431.1|GH3	1.05e-242	8	842	9	838
UPK99435.1|GH3	1.11e-236	13	837	9	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	8.68e-170	12	832	8	828	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	3.56e-165	12	832	8	828	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.29e-121	9	841	4	669	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.30e-105	14	841	9	664	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.76e-104	12	846	6	719	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.70e-251	8	828	9	826	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	2.02e-168	14	826	10	816	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|P27034|BGLS_RHIRD	1.24e-167	12	843	4	811	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|P07337|BGLS_KLUMA	3.00e-166	12	832	8	828	Beta-glucosidase OS=Kluyveromyces marxianus OX=4911 PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	2.97e-164	14	826	10	816	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000002

TMHMM  Annotations     

There is no transmembrane helices in EEU35660.1.