CAZyme Information: EEU35586.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU35586.1
• CAZy Family: AA7
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:C7ZK62]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
851	GG698937|CGC1	93361.60	5.2006

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698937:112174-114847(+)

Full Sequence      

MSPDSLHNILSSLTLEEKIRFLSGVDWWRTPVIQRDGVFVPHIKFTDGPNGARGESYVSG
IKAACFPCGTCLGSTFDTSILERIGAAIAKEAETKSANVLLGPTLNVIRSPLGGRNYETY
SEDPLVLGHLAAAYVRGCQSTGRVAATPKHFVANDAENQRTTLSVEVEEQALREIYLKPF
QLVLKLSDPWCIMSSYNRVQGTYVADSDELINGVLRDEWGFQGPVISDWMGTYSVAPGIN
AGVDIEMPGPPKWRTPDAVSKLVQQGSITEETINKSVLRILKLAYRLGRFENPEEPPERA
VEDQARDDLIKEAAADGIVLLKNAGDILPISKSSTVALIGQHASSVVLGGGGSARVDALH
AVTPIEGFQRLGYDTRTAAGVPVFGAVPHADPSSVFPTGQPQHSELPVRLEWFNGSVIGE
NLVHEEFRPQAEYMIKEQWPEYLDKISYCTRITFDLVAPSTGNAIFSVISTGRAKCYIDG
QLVFERPQETKLRPESFYFFKKQLERRFTHNVEEGRRYSIKLESWACDPDILAGPPLFGK
MFQGSSIRFHEEINLQASLNDAKKVASEAEYAIVCVGTTNEIESEGFDRDTMDLTPEQYD
LVKAVASSNSKTVVVNFSGAPVSLSQIVDVVPGIVQAWFPGQEAGLSVAAVLSGQVNPSG
RLPLTWPRKLEDGPSFGNFPAGPDDILRYEEGLDVGYRWYDQASKPKPLYPFGFGLSYTR
FQIVSVEIQKGRATLGPDGEVLVKARVANVGSRQGKAVVQFYVSGPQDSPIPGLSRPVKE
LQAFEKVEIGPGETKVVEARLDKYSVSVYDSVAKRWHAEKGEYTVRVGLSSDQVHTRVSF
SVPETFTWTGI

Enzyme Prediction     

No EC number prediction in EEU35586.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	40	248	5e-61	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.13e-71	66	836	120	759	beta-glucosidase BglX.
224389	BglX	8.13e-71	40	366	60	384	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.22e-50	553	697	75	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	5.33e-45	9	815	56	757	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.38e-36	66	283	88	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95967.1|GH3	0.0	1	851	1	851
QKD60297.1|GH3	6.85e-318	9	851	10	834
CEI61625.1|GH3	6.85e-318	5	851	6	834
CCT75026.1|GH3	1.53e-314	8	851	6	831
QPC70584.1|GH3	4.84e-314	8	851	9	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	6.02e-167	1	851	1	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	4.42e-163	2	851	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	3.72e-126	6	845	5	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
2X40_A	1.02e-101	4	844	2	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	1.47e-100	4	844	2	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	5.57e-174	1	842	6	838	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	2.54e-167	6	843	2	811	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	2.17e-164	9	851	16	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DNN8|BGLJ_NEOFI	1.80e-163	1	851	9	864	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	1.32e-162	10	851	10	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EEU35586.1.