CAZyme Information: EEU35487.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU35487.1
• CAZy Family: PL4
• CAZyme Description: Glycosyltransferase family 2 protein [Source:UniProtKB/TrEMBL;Acc:C7ZK99]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
693		77457.71	8.2858

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698938:20092-22263(+)

Full Sequence      

MTVPSNSPFWSNEDPSNEDLILPCNARLDPAVSEAQPNRPAPLSSPSTRSLNDPFATPPP
ASPALSPITSPPQAISSDRTSRKVGIYGPYLDSAGSSENSLSSQAGQRLTTPGPADEKSS
ANAKKRSLWTRFWHAVANQISPKALWDLINPKEYLYPMTVKKYLALAGVCACVAAIVISN
HYTHWMTKAIAQTRSYMLPVLVIVLTIEPTMFLIIMCIAKVPPYNPPATDTPQVVQEAFN
EKSAGDLERGVGVTTASKVWEAAFVIPCHNSDREALQKVLESAYPYFRPQDIFVIDNART
RYPKDLSFRYWLRALNPDINYIWSPIGSKNAAQLVGSLAAKNYKYILTTDDDVSLPNNYR
HPTHLMDDQIKAVAFPLIGIDAEGNTPLGMVSWQDCEYRMAGLTKLAEYRTCGVNFPHGA
GWFVDRDTFVELLTKYHPMDFIAEDANAGFAMMRLNKRIAFDAQVTLATEVPSTLLGPGL
NWCKQRVKSWEMGRHSLIWKLFRHLFRMNGQRTVSGIGVQKFLFLYTLTCLVIDWVRIPV
LVALGAHKDYWIFFCSLAFVAAVPPVLYNYISCRHRPDMRIGLVTAATYPFYKQLYAFIS
VLGAVRWALFYIGGHVRAKPIRKMLKDGDDACFWLDPRFETNPAWLADEREQQLANESAS
ATIVDSSPAHSRDNSQAHNSSHSTGDVWHCKHG

Enzyme Prediction     

No EC number prediction in EEU35487.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224136	BcsA	5.90e-12	263	622	57	418	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	1.13e-06	265	445	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
132997	Glyco_tranf_GTA_type	0.001	265	376	2	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
404513	Glyco_trans_2_3	0.008	345	506	1	154	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133043	CESA_CelA_like	0.010	262	493	3	229	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGI79854.1|GT2	0.0	1	663	1	650
QGI62687.1|GT2	0.0	1	663	1	650
QGI93580.1|GT2	0.0	1	663	1	650
QKD50674.1|GT2	0.0	1	659	1	655
CCT66493.1|GT2	0.0	1	663	1	650

PDB Hits     

EEU35487.1 has no PDB hit.

Swiss-Prot Hits     

EEU35487.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

Start	End
164	186
196	218
514	536
551	573
594	616