CAZyme Information: EEU35308.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU35308.1
• CAZy Family: AA7
• CAZyme Description: Glyco_transf_28 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7ZKX3]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887		96875.23	8.5757

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698942:6735-9524(-)

Full Sequence      

MALNRVVSRGPGHIALDESNMHHGPSSDVISDGRVKVQFHDNPEALAIWCDRFRSSFAGE
LPSLEHLEPPKPRRTKSFEVLADVEKPAAGPRLNIAIHIVGSRGDVQPFIPIAQLLMKPP
YGHRVRICTHPVFKDFVEAQGVEFFSIGGDPEALMAYMVKNPGLLPSRESLRGGDVGKRR
REMSEIIDGAWRSCIEAGDGMGERVTAADVKNADDLFIADAIIANPPSMAHIHCAEKLGI
PLHMVFTMPWSPTKAFPHPLAAMSYGEADKSTANYLSFMMMELLTWQGLGDLINKFRAQT
LHLDPVSPMWGFQLLPRLRVPYSYLWSESLIPKPTDWESHLNITGFSFLPLANSYTPPQD
LVDFLNGGPAPIYIGFGSIVVDDPQALTRMIFQAVKIAGVRAIVSKGWGGVGTGDVPENV
YLIGNCPHDWLFKRVSAVVHHGGAGTTAAGIAAGRPTVIVPFFGDQPFWGQMMARAGAGP
TSVPFKDLTAEILAESITFALKPEVQDVAMEMALNIEEEDGAGYAAMDIQDRLEMDNMRC
DICPERLATWLHRKSGAHLSGFAASCLVDKGLMTPEDIKPLRHKHWYVDEGAEHPVIGAI
AAASGFVSAVGTATADYSKRLKAPTPVRPRRRSSVGGKNFPLPGDEETHIGVLGDVVGPD
SLTPTDMRVVAQKMAEKSLCTAYPSAAIVRPAASIHQKHKKAWKSHEQGRYGRGYYVTRV
TGRYACDLAKAAAKAPVAFFYNVANGFHNVPSYGWAGVDVRRRDEITGLGSGIKTAGKEF
SLGTWDAFSGLVKKPYEDSKQRGIKGLGRGIARGGLGFFSNLGSAFFGLPGYTLKGLEKE
LHKHHLTKLKAEILLIRLRQGINDWRNATPEQKTEVVRRWKALGLAN

Enzyme Prediction     

EC	2.4.1.173:23	2.4.1.-:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	207	529	1.4e-56	0.7670157068062827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	7.87e-65	93	526	1	398	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
224732	YjiC	2.05e-29	95	526	4	392	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
397255	Glyco_transf_28	1.31e-19	95	257	1	139	Glycosyltransferase family 28 N-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). This N-terminal domain contains the acceptor binding site and likely membrane association site. This family also contains a large number of proteins that probably have quite distinct activities.
273616	MGT	8.27e-05	372	529	228	386	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK91708.1|GT1	0.0	1	887	1	887
CZS80737.1|GT1	0.0	1	883	1	885
QKD55584.1|GT1	0.0	1	885	1	891
QPC58826.1|GT1	0.0	1	876	1	878
QGI65525.1|GT1	0.0	1	885	1	891

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XVM_A	8.49e-77	100	534	27	440	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C],5XVM_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Saccharomyces cerevisiae S288C]
5GL5_A	1.44e-76	100	534	47	460	Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C],5GL5_B Sterol 3-beta-glucosyltransferase (ugt51) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c): UDPG complex [Saccharomyces cerevisiae S288C]
1IIR_A	5.14e-33	93	536	1	401	Crystal Structure of UDP-glucosyltransferase GtfB [Amycolatopsis orientalis]
3H4I_A	1.90e-32	93	526	1	374	Chimeric Glycosyltransferase for the generation of novel natural products [Amycolatopsis orientalis],3H4T_A Chimeric Glycosyltransferase for the generation of novel natural products - GtfAH1 in complex with UDP-2F-Glc [Amycolatopsis orientalis]
1RRV_A	3.19e-23	93	526	1	392	X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis],1RRV_B X-ray crystal structure of TDP-vancosaminyltransferase GtfD as a complex with TDP and the natural substrate, desvancosaminyl vancomycin. [Amycolatopsis orientalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9XIG1|U80B1_ARATH	4.02e-129	64	525	128	566	Sterol 3-beta-glucosyltransferase UGT80B1 OS=Arabidopsis thaliana OX=3702 GN=UGT80B1 PE=1 SV=1
sp|Q9M8Z7|U80A2_ARATH	1.11e-123	91	525	191	602	Sterol 3-beta-glucosyltransferase UGT80A2 OS=Arabidopsis thaliana OX=3702 GN=UGT80A2 PE=1 SV=1
sp|Q6C8M8|ATG26_YARLI	8.69e-77	100	479	1002	1361	Sterol 3-beta-glucosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ATG26 PE=3 SV=3
sp|P0CN90|ATG26_CRYNJ	1.92e-76	93	610	1034	1545	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=ATG26 PE=3 SV=1
sp|P0CN91|ATG26_CRYNB	1.92e-76	93	610	1034	1545	Sterol 3-beta-glucosyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=ATG26 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EEU35308.1.