CAZyme Information: EEU35073.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU35073.1
• CAZy Family: AA7
• CAZyme Description: GMC_OxRdtase_N domain-containing protein [Source:UniProtKB/TrEMBL;Acc:C7ZLQ8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
652	GG698946|CGC3	70041.37	5.4107

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698946:166618-168634(+)

Full Sequence      

MRCTTFLAVTLSTLVTAADVPFISTLLDPLQAVIQSAFAGDGVKVGELGSLGGVPGVDAT
YDYVVVGGGTAGNTIGYRLAKAGFSVAIVEAGSFLEIAKPILATAPGGVTCGSGSSLLDS
NPLRDWRFTTTPQTNADDREIHYARGKVLGGSSQLNFLVYHRPTNGTMEKWAKEVGDDSY
KWDQMLPHFQATPSFTPPDNTKRGPNVTTDYDPAAFASTGGPIQVSYANYVPSWATYVEK
GLKSLGLKSIDGFSSGSLLGYSYTTTSVRPKTATRSASDDFVKAARSEKLETLKVYTQSL
AKRVLFNSDKKATGVEVSSLGMQYTLTARNEVIVSGGAFQSPQILMVSGVGPKKHLEEFD
IDVVADLPGVGQNLWDHILFGPSFEVQGLEDTLSVAINDPAVFQGALDAYAGQQAGPLTS
NQVELLGWEKVPKKYRSKFSNETLKKLSAFPSDWPEVEFIPLNVYSEDWSFPILQQPSDG
KKYTSINGALVAPLSRGNITLQSNSTTDAPLINPNFLGDKGDQEVAIALFRRLREVAKST
PLKNIVLNEVYPGAKYETDEQILAVLRDTLMTVWHAACTCKMGKAEDKMAVLDSKARVYG
VKGLRVVDASAFPVLIPGHPLGTVYALAEKIAHEIITEQGSASYEVEVNIGA

Enzyme Prediction     

No EC number prediction in EEU35073.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	60	636	2.2e-176	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.72e-95	57	643	4	541	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	3.60e-94	60	635	5	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	5.94e-40	493	631	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	5.29e-30	56	612	51	553	Protein HOTHEAD
366272	GMC_oxred_N	2.92e-25	134	377	12	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92142.1|AA3_2	0.0	1	652	1	652
QPC62877.1|AA3_2	0.0	1	650	1	655
CZS85865.1|AA3_2	0.0	1	650	1	655
CEI70575.1|AA3_2	0.0	1	652	1	655
CEF88560.1|AA3_2	0.0	1	650	1	655

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	4.07e-60	61	639	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	7.96e-60	59	639	1	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
3Q9T_A	4.25e-55	61	638	7	572	Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_B Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40],3Q9T_C Crystal structure analysis of formate oxidase [Aspergillus oryzae RIB40]
5ZU3_A	5.86e-55	61	638	7	572	Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_B Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU3_C Effect of mutation (R554K) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]
5ZU2_A	8.09e-55	61	638	7	572	Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_B Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40],5ZU2_C Effect of mutation (R554A) on FAD modification in Aspergillus oryzae RIB40formate oxidase [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CFL2|PATE_ASPCL	1.40e-163	32	635	21	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.62e-163	48	638	23	610	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	5.02e-161	48	635	40	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	7.60e-150	18	632	5	604	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1
sp|Q12062|AFLK_ASPPU	5.64e-143	60	639	74	643	Versicolorin B synthase OS=Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) OX=1403190 GN=aflK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000265	0.999706	CS pos: 17-18. Pr: 0.9787

TMHMM  Annotations     

There is no transmembrane helices in EEU35073.1.