CAZyme Information: EEU35055.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU35055.1
• CAZy Family: AA7
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:C7ZLM2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	GG698946|CGC2	92829.69	4.9999

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698946:64998-67735(+)

Full Sequence      

MGDISSFLSEEKSLFDVEHVLKELTTNEKIDLLAGVDFWHTKAIPRLNVPSIRMSDGPNG
VRGTRFFNGVPAACFPCGTGLAATWNTDLLREAGHLMGTEARAKGAHVLLGPTVNMQRSP
LGGRAFESFSEDPVLSGNCASAIISGIQSTGVVASIKHFVANDQEHERMAVDSLVTERAL
REIYTLPFQIAVRDSNPGSFMTSYNKVNGVHVSENRDMIEKIVRKEWGWQGLVTSDWYGT
YSTVESLEAGLDIEMPGPTRWRGQMLLHALMSRKIDIEAINERVREILKLVRRAVQTGIP
ENAPEQGRDTPETASLLRTIASEAVVLLKNENNALPFKKDEKVVVIGPNAKTAVYCGGGS
ATLRPYYAISPFEGVSKKTDNLSYSVGCYAHKMLPLLGSRLRTKDGQPGVTFTAFTSPDT
VKDRVAVDTIHLDTTDMYFADYYHPEITENLWWGEIEAVFEADETGDFEFGLTVFGTARL
YVDDELVVDNETTQRPGGTFFNVGTVEETGVRRLTAGQTYKIRVVFASGAASKLGDAEGV
VSYGSGGLRIGGARVIDPEDEIAKAVELAKTADQVVLFVGLNSDFEQEGHDRPHMDLPGR
TDELVSAVAAANPKTVVVVQSGSPVTMPWANSVAAVIQAWYGGNETGNAIADVLFGDVNP
SGKLPLSFPIRVEDNPAFFNYRSEHGRVLYGEDVYVGYRFYETIKRPTLWSFGSGLSYTT
FDLLDLSIQQEQRNGRELLLIDVGIKNTGSVDGAQVVQVYVTARSSSIKRPVKELKGFSK
VFVKAGETVITKISIERKYATSIWDETRHKWVEEAGTYDVLVGDSSSNIQLKGQFEVSDT
TWWSGL

Enzyme Prediction     

EC	3.2.1.21:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	42	256	7e-69	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	3.41e-84	75	836	120	763	beta-glucosidase BglX.
224389	BglX	3.49e-70	7	351	17	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	2.76e-62	325	698	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	2.04e-56	24	824	60	770	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.25e-40	62	290	78	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92097.1|GH3	0.0	1	846	1	846
QKD55191.1|GH3	0.0	1	846	1	851
UQC79070.1|GH3|GH78	0.0	6	842	29	865
UQC84651.1|GH3	0.0	15	846	4	833
CCD50485.1|GH3	0.0	15	846	5	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	9.51e-273	13	846	2	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.30e-267	13	846	2	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	8.83e-148	16	840	4	671	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.49e-126	21	829	9	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.49e-113	17	839	4	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8NDE2|BGLI_ASPFN	0.0	16	846	5	839	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1CA51|BGLI_ASPCL	0.0	15	846	4	838	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	0.0	16	846	5	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|A2R989|BGLI_ASPNC	0.0	33	846	1	818	Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglI PE=3 SV=1
sp|Q5BB53|BGLI_EMENI	0.0	16	846	5	839	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000007

TMHMM  Annotations     

There is no transmembrane helices in EEU35055.1.