CAZyme Information: EEU34937.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU34937.1
• CAZy Family: AA5
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:C7ZM57]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	GG698949|CGC1	93807.52	5.5592

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698949:120682-123467(-)

Full Sequence      

MTRPNIDQLIQELTLREKISLIAGASTWRTSEVARLGIPNLKVSDGPSGARGEVFGEGVP
AAFLPCGVSLGATWDEELLFEVGQLLASECKTKSASVSLAPTMCIHRHPLGGRNFESFSE
DPFLTGKLASAHVRGVQSQGIGATPKHFVANDQETDRFKYSAEIPPRALREVYLLPFQMV
VRDANPWCLMTSYNRVNGTYCDMSKELLTDIVYGEWGWDGVFMSDWGGTHSCVQSINAGL
SLEMPGPPAHRAEDLIILEAENGNVDLHQLELSVRRILKLLEKTGRFQDASDAAEFCDDS
PRKREALLKFASSGVVLLKNEGNALPLNSKVGIKKLAILGPNSKRVVAGGGGSSYIKAPY
WTNIHDSIKAKLDGTTTEILHHDGAKVNRYLPTMPSSLARNPLTGTPGGSIEWFLGRDFT
SPVPLFKYALLTTTSEDLYYMSFGNTPKGVPGETNFSFRLRTVLTPKTSGPHAVSFASIG
PAKFYLDDLLLAAFDGTEKSTLFFTYGSDETICKLDLIAGRDYHIRVDAHSHDRQLDPDL
RALMDPMEDKFQGVRIGYQEYSDADFPAQAAQVAKESDVAVIVVGRDREWETEGQDIPTF
ELPGEQERLIRQVSTVCKKTVVVVQGGTPIKLEPWIHEVSAVLYAWYQGQELGNAVADVI
FGDFNPSGRLPVTFPIRIEDCPAYSSFPGEQGKSFYSEGIYVGYRWWDLLKIKPLFPIGF
GLSYSTFEWSDARVEPSNLYSGSHVLLSAKVQNLEGLAGRETLIAWCREVSMSGLSRPSK
QICGFVKTESIKPGESAHVQIKIDAYGLAAYSPADAKWIIRGGSEFEILLGTNSLSAVPV
GSISTPSEISFVHTM

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	31	245	3e-64	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.71e-64	32	360	54	378	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	5.33e-49	34	834	100	754	beta-glucosidase BglX.
396478	Glyco_hydro_3_C	5.58e-47	553	704	67	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.11e-38	31	280	59	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.99e-27	9	730	56	639	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS07145.1|GH3	0.0	4	853	10	856
BCR94550.1|GH3	0.0	4	853	10	856
QQK45361.1|GH3	4.31e-219	10	853	18	860
EGX47427.1|GH3	7.82e-219	7	834	12	838
QRC98638.1|GH3	1.03e-217	8	834	67	876

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.35e-160	1	849	1	840	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	9.35e-156	5	849	5	840	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.29e-123	5	849	4	672	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.41e-109	10	848	9	666	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	3.98e-103	6	851	4	719	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.68e-179	6	831	11	824	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	2.30e-176	6	848	2	813	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|Q5BA18|BGLK_EMENI	2.58e-174	5	834	12	818	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|A1DNN8|BGLJ_NEOFI	1.39e-167	6	838	14	849	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	1.02e-166	1	832	1	818	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999996	0.000052

TMHMM  Annotations     

There is no transmembrane helices in EEU34937.1.