CAZyme Information: EEU34609.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU34609.1
• CAZy Family: AA3
• CAZyme Description: Endo-1,4-beta-xylanase [Source:UniProtKB/TrEMBL;Acc:C7ZN05]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
173		19371.18	6.4872

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698960:74058-74629(+)

Full Sequence      

YHYWWTDSGRDVNFTSFDGGSYSIEWSKGANFIGGKGWNPGGRKNVKYSGTYSPNGNSYL
ALYGWTTSPLVEYYVVESFGNNDPSTDKEKKGEVTSDNGIYDIYVSSRKNVSSSEQTVKQ
YWSIRREKHINGTITTGNHFDAWARVGLELGSFEYMIMATEGHLSSGFASITV

Enzyme Prediction     

EC	3.2.1.8:61

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH11	2	171	4e-58	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395367	Glyco_hydro_11	4.56e-84	1	170	4	175	Glycosyl hydrolases family 11.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92982.1|GH11	1.65e-115	1	173	43	215
UPK97272.1|CBM1|GH11	7.81e-84	1	173	43	217
UQC81319.1|GH11	4.20e-77	1	173	51	225
AIG53790.1|GH11	1.24e-76	1	173	43	218
AKO22614.1|GH11	1.24e-76	1	173	43	218

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JRM_A	1.85e-68	1	173	18	192	Crystal Structure of a Xylanase at 1.56 Angstroem resolution [Fusarium oxysporum],5JRN_A Crystal Structure of a Xylanase in Complex with a Monosaccharide at 2.84 Angstroem resolution [Fusarium oxysporum f. sp. vasinfectum 25433]
6Y0H_A	3.60e-68	1	173	17	192	High resolution structure of GH11 xylanase from Nectria haematococca [Fusarium vanettenii 77-13-4]
7DFM_A	1.51e-67	1	173	17	190	Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFM_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 [Streptomyces olivaceoviridis],7DFN_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFN_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with alpha-L-arabinofuranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_A Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_B Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_C Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_D Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_E Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_F Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_G Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_H Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis],7DFO_I Crystal structure of glycoside hydrolase family 11 beta-xylanase from Streptomyces olivaceoviridis E-86 in complex with 4-O-methyl-alpha-D-glucuronopyranosyl xylotetraose [Streptomyces olivaceoviridis]
1TE1_B	7.18e-65	1	173	15	189	Crystal structure of family 11 xylanase in complex with inhibitor (XIP-I) [Talaromyces funiculosus]
5EJ3_A	4.08e-64	1	173	57	230	Crystal structure of XlnB2 [Streptomyces lividans],5EJ3_B Crystal structure of XlnB2 [Streptomyces lividans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48824|XYNB_ASPKW	4.11e-71	1	173	50	224	Endo-1,4-beta-xylanase B OS=Aspergillus kawachii (strain NBRC 4308) OX=1033177 GN=xlnB PE=3 SV=2
sp|P55330|XYNB_ASPNG	1.17e-70	1	173	50	224	Endo-1,4-beta-xylanase B OS=Aspergillus niger OX=5061 GN=xlnB PE=1 SV=1
sp|A2Q7I0|XYNB_ASPNC	1.17e-70	1	173	50	224	Probable endo-1,4-beta-xylanase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xlnB PE=3 SV=1
sp|B8NKE9|XYNA_ASPFN	1.69e-69	1	173	57	231	Probable endo-1,4-beta-xylanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xlnA PE=3 SV=2
sp|Q9HFA4|XYNA_ASPOR	1.69e-69	1	173	57	231	Endo-1,4-beta-xylanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xlnA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999981	0.000062

TMHMM  Annotations     

There is no transmembrane helices in EEU34609.1.