CAZyme Information: EEU34135.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU34135.1
• CAZy Family: PL26
• CAZyme Description: Glucan endo-1,3-beta-glucosidase eglC [Source:UniProtKB/TrEMBL;Acc:C7ZPF2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		33888.16	7.2376

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG698970:800011-800973(+)

Full Sequence      

MLSTSHLLALAITLGAVNAAFQGFNYGTTLADGSAKTQVDFENEFKTAASLEGTGGAFKS
ARLYTMIQGGTPNDPVSAIPAAIKTKTSLLFGLWASGGDAAFGNEIAALKKTAEQYCSQL
NHLVAGISVGSEDLYRNSPIGIKNKENPGVNPDTLVNYISQTRNAVKGTCLETIPIGHVD
TWTAYVNGSNKAVIDACDWLGMDAYPYYEDTKHNPVSEGPSLFNAAKDKVKAVAGGKEIW
ITETGWPISGKTSGEGVASVSNARTYWKDVGCPMFGSTNVWWYTLLDAGTQSSNPSFGVV
GSKLTKKPLYDLSCGKKRGA

Enzyme Prediction     

No EC number prediction in EEU34135.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.11e-27	21	302	45	303	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	5.22e-08	129	314	108	309	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02404.1|GH17	2.04e-222	7	320	7	320
CEI68891.1|GH17	2.95e-171	1	314	1	312
CCT64267.1|GH17	2.09e-170	1	317	1	314
QPC78631.1|GH17	4.25e-169	1	314	1	312
QPC61276.1|GH17	2.36e-168	1	314	1	312

PDB Hits     

EEU34135.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WG16|EGLC_ASPFU	3.77e-135	5	314	4	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=eglC PE=3 SV=1
sp|B0XXF8|EGLC_ASPFC	4.29e-135	5	314	4	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=eglC PE=3 SV=1
sp|A1DJ47|EGLC_NEOFI	1.40e-133	5	320	4	316	Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=eglC PE=3 SV=1
sp|Q2UUZ1|EGLC_ASPOR	9.20e-130	5	314	4	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=eglC PE=3 SV=1
sp|A1CD22|EGLC_ASPCL	2.65e-124	2	314	1	310	Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=eglC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000314	0.999674	CS pos: 19-20. Pr: 0.9721

TMHMM  Annotations     

There is no transmembrane helices in EEU34135.1.