CAZyme Information: EEU33401.1

Basic Information

• Species: Fusarium vanettenii
• Lineage: Ascomycota; Sordariomycetes; ; Nectriaceae; Fusarium; Fusarium vanettenii
• CAZyme ID: EEU33401.1
• CAZy Family: AA1
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:C7ZRF5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
835	GG699074|CGC1	92248.72	5.1709

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Fvanettenii77134	15708	660122	0	15708

• Gene Location: location=GG699074:5443-8348(+)

Full Sequence      

MTVQPTLADVDVDVLISRLTLEEKIELLTGQGSFKTTSLQAHGIPSITVSSDPTVPSVLL
SSATAMGATFDVDLMHRIGNLLGEEARYKNVNVLLAPTVCLQRSPLMGRGFEAFGEDPVL
SGMIASAYINGIQERGVAACIKHYAAHDQSTMSIEDNVRMTDRTLRELHLLPFQLAYRHS
NPWSFMTSYNKINGIHASEDPLLLRQILRHEWGFDGLVMSDWWGTYSTAESINAGMDLEM
PGPTQFRGKLLEIAIKTRKVSRMAVDAAARNVLNFVKKVTVAAEPWKGDPSSANTPENRA
LVRKLAADSIVLLKNDENILPIKNRNAKSYGLIGDHFKLPALSGGGSAEGDPYYSITPYD
AMVEAVGEENITFTPGLYTFKFVPFLKNLNQPGTSNHGWWVDIFDHDPDQVPNAEVVYST
ATDKDLIDVPESLHKHLPHKYYVRARATFTPDASARFRFGFSVAGKGKVKLDNEDAIDLW
VDQPPKTEDTPCFNRLSMERFYEMDLQRGKPVDVEVLMVNEDVSGGVGTAFTLAGRLGGY
EILAPEQGLAKAIKIAQSVDVPIIMAGLSADYESEASDRKDLELPPAGVKLVQAVLDANP
SAIVVTQAGCPIEMPWEPQCKTLLHAWYGGQETGHGIVDILFGDVNPAGRLSVTFPRSIK
HTPTYLAFGKSDHDILYGEGVFIGHRFYEKVDRDPLFYFGHGLSYTNFAYSSLIVPPIFE
PSAEHEATIAVNVENDGSYDGAEVVQLYIRAPESPVQRPVRELKAFKKVELAAGETKTVC
LRLDKYAVSYWSEEYGQWRAENGCYDVIIASSSNPKDEVLRSRFKLPESFLWSGI

Enzyme Prediction     

No EC number prediction in EEU33401.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	60	241	1.6e-61	0.8611111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	9.46e-77	65	826	125	764	beta-glucosidase BglX.
224389	BglX	9.72e-62	62	372	85	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.87e-46	532	684	64	215	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	4.27e-43	15	784	56	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.87e-39	59	274	87	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK95841.1|GH3	0.0	8	835	5	839
QKD62631.1|GH3	0.0	10	835	7	840
CEI61952.1|GH3	0.0	10	835	7	840
CCT75598.1|GH3	0.0	10	835	7	837
QPC71061.1|GH3	0.0	10	835	7	840

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	2.62e-174	11	835	5	845	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.09e-169	11	835	5	845	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.99e-123	10	826	3	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.17e-97	16	813	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	2.49e-88	12	813	4	702	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA18|BGLK_EMENI	2.29e-210	3	835	4	838	Probable beta-glucosidase K OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglK PE=2 SV=1
sp|Q5B6C7|BGLH_EMENI	4.12e-209	11	835	6	831	Probable beta-glucosidase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglH PE=3 SV=2
sp|A1DPG0|BGLH_NEOFI	3.10e-205	8	835	3	829	Probable beta-glucosidase H OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglH PE=3 SV=1
sp|A1DFA8|BGLI_NEOFI	8.21e-205	7	835	1	838	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	4.62e-204	7	835	1	838	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999698	0.000344

TMHMM  Annotations     

There is no transmembrane helices in EEU33401.1.