CAZyme Information: EEQ91403.1

Basic Information

• Species: Blastomyces dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces dermatitidis
• CAZyme ID: EEQ91403.1
• CAZy Family: GH43
• CAZyme Description: polysaccharide export protein, variant

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		48559.40	9.1921

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BdermatitidisER-3	10081	559297	326	9755

• Gene Location: location=EQ999979:139094-140564(+)

Full Sequence      

MLVSPRGYHRWWRALLGPIFFPRRGSSHGHISVLLTSCIAFFAVVDYLIFTASSISSPRE
STDTTVVPGIRSVYVASTHWNNEAILRSHWNAAVVELARKFGKDNIYVSVYESGSWDDSK
GALRELDQQLEELGVDRTIILDPATHEDEINKPPGREGWIDTPRGKRELRRIPYLAHMRN
RSLEPLERLVQAGRTFDKIIFLNDVIFSMTDIITLLNTRSGSYAAACSLDFGKPGLFYDT
FALRDSKGSPAFSQRYPYFSARRSRNALIAGKPIPVQSCWNGIAIFDAAPFQTSTNPLRF
RGIPDSLAKYHLEGSECCLIHYDNPLSATKGVWLNPNVRVGYNLVAYEAAAARVWPSTLD
AVLVGWWKGFFASMLDLPWRSRAVVGRVKKWAREGESFNNEKERKGNREVGLPCLIDEMQ
IIVYNGWAHV

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT69	73	325	9.2e-84	0.9874476987447699

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403053	CAP59_mtransfer	7.58e-119	73	320	2	225	Cryptococcal mannosyltransferase 1. The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1, EC:2.4.1.-.
274285	TraI_TIGR	1.78e-04	93	198	1838	1947	conjugative transfer relaxase protein TraI. This protein is a component of the relaxosome complex. In the process of conjugative plasmid transfer the realaxosome binds to the plasmid at the oriT (origin of transfer) site. The relaxase protein TraI mediates the single-strand nicking and ATP-dependent unwinding (relaxation, helicase activity) of the plasmid molecule. These two activities reside in separate domains of the protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS60954.1|GT69	1.99e-221	64	430	41	435
QSS72352.1|GT69	6.12e-178	129	430	2	319
QSS55756.1|GT69	2.98e-169	1	286	1	291
QKX55062.1|GT69	2.29e-147	73	430	59	412
CAK38741.1|GT69	6.02e-141	20	430	10	416

PDB Hits     

EEQ91403.1 has no PDB hit.

Swiss-Prot Hits     

EEQ91403.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999998	0.000010

TMHMM  Annotations     

There is no transmembrane helices in EEQ91403.1.