CAZyme Information: EEQ91051.1

Basic Information

• Species: Blastomyces dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces dermatitidis
• CAZyme ID: EEQ91051.1
• CAZy Family: GH37
• CAZyme Description: mannan polymerase II complex ANP1 subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	EQ999978|CGC1	54781.76	6.3708

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BdermatitidisER-3	10081	559297	326	9755

• Gene Location: location=EQ999978:2422311-2424041(-)

Full Sequence      

MKGHSPYSNGYTAYPRGEGGTFSISPHRFQPRSHSALRRRQQLIQRLCVLGGFSFFILLL
IFPSWRAAILGTITFGLFSSVDDFQPETVRYYDLSDFQGTARGWERQERVLLCTPLRDAE
PHLPVFFSHLRNFTYPHHLIDLAFLVSDSKDNTLETLTKMLEELQDDPDPKQHYGEISVI
EKDFGQKVKQDVESRHGFAAQASRRKLMAQARNWLLSATLRPTHSWVYWRDADVETAPFT
ILEDLMRHNKDIIVPNVWRPLPDWLGGEQPYDLNSWKESETALALADSLDEDAVIVEGYA
EYATWRPHLAYLRDPYGDPDMEMDLDGVGGVSILAKARVFRSGVHFPAFSFEKHAETEAF
GKMAKRMKFSVVGLPHYTIWHLYEPSLDDIRHMEEMERERKAREAEEKEKAERAKFVQEQ
FKDTRDEWAKDGEAIKDILKKDELAKKGEKKDEKKQNVGKRSNSGGEGVGQQQQQ

Enzyme Prediction     

No EC number prediction in EEQ91051.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	87	350	8.1e-124	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	1.19e-159	88	350	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS53764.1|GT62	7.49e-301	1	475	1	475
QSS75645.1|GT62	7.49e-301	1	475	1	475
QKX57946.1|GT62	3.76e-248	1	436	1	437
QRD89585.1|GT62	2.12e-245	1	453	1	456
UDD59518.1|GT62	5.17e-245	1	453	1	456

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	4.82e-61	89	386	6	304	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	3.16e-163	55	435	25	408	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	5.06e-160	18	400	10	390	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	5.16e-125	88	400	171	530	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	4.58e-122	80	400	67	437	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	3.00e-63	83	384	67	368	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999966	0.000044

TMHMM  Annotations     

Start	End
47	69