CAZyme Information: EEQ89827.1

Basic Information

• Species: Blastomyces dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces dermatitidis
• CAZyme ID: EEQ89827.1
• CAZy Family: GH20
• CAZyme Description: beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		54526.25	4.9978

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BdermatitidisER-3	10081	559297	326	9755

• Gene Location: location=EQ999977:1440366-1442207(-)

Full Sequence      

MSTTTSKLPSDFLWGFATASYQIEGAIEADGRGPSIWDTFCNIPGKIADGSSGKTACDSY
NRTSEDIALLKLCRAGAYRFSLSWSRIIPLGGRNDPINEKGLQHYVKFVDDLLAAGITPI
VTLLHWDLPDELHKRYGGYLNKNEFVADFARYARVVFKELSPKVKYWITFNEPWCSSILG
YNTGQFAPGRCSDRSKSAEGDSSREPWIVGHTLLVAHGAVVKIYREEFKARDGGEIGITL
NGDWALPWDSENPADVEAANRKLEFSISWFADPIYFGKYPDSMLKQLGDRLPTWTEAERA
LVQGSNDFYGMNHYCAHFIKNRTDEPAPGDFFGNIESLMEDKNGNPVGPETQSEWLRPYP
LGFRKLLKWLSDRYGRPKIYVTENGTSLKGENDLPLAQLLDDEFRVEYFRGYIGTMADAY
ALDNVDVRAYMAWSLLDNFEWAEGYITRFGVTYVDYEGGQKRYPKKSASEIGNIFDAYME
KP

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	5	475	4.5e-157	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	1.90e-176	8	468	5	441	Glycosyl hydrolase family 1.
225343	BglB	3.15e-136	5	468	1	443	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	8.59e-111	6	468	28	473	beta-glucosidase
215435	PLN02814	3.27e-109	4	469	24	474	beta-glucosidase
184102	PRK13511	7.48e-97	5	468	2	456	6-phospho-beta-galactosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12207.1|GH1	1.54e-297	2	481	3	482
BCS00431.1|GH1	1.54e-297	2	481	3	482
CAK47813.1|GH1	1.22e-296	2	481	3	482
QEV81508.1|GH1	9.98e-296	2	481	3	482
QRD82378.1|GH1	2.01e-295	2	481	3	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	4.30e-267	7	481	25	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	5.37e-241	8	481	3	465	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	5.92e-238	8	481	3	465	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	1.18e-237	8	481	22	484	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	8.40e-235	8	476	9	467	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	9.20e-197	6	479	9	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	3.94e-174	4	480	2	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	1.52e-148	6	474	31	501	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q7XKV4|BGL12_ORYSJ	2.01e-142	7	468	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|B8AVF0|BGL12_ORYSI	2.01e-142	7	468	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999927	0.000126

TMHMM  Annotations     

There is no transmembrane helices in EEQ89827.1.