CAZyme Information: EEQ85274.2

Basic Information

• Species: Blastomyces dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces dermatitidis
• CAZyme ID: EEQ85274.2
• CAZy Family: AA4
• CAZyme Description: aryl-alcohol dehydrogenase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
384	EQ999983|CGC5	42262.66	4.9012

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BdermatitidisER-3	10081	559297	326	9755

• Gene Location: location=EQ999983:1714886-1716443(+)

Full Sequence      

MLGGSSAINGQAFVSASKGGWTWENVQPYYRKSYTLNLPDEETREHLGLKWVGPSVHGFS
GPIQASFPGEVQNPLVKAWVDISKNIGYEATADPYSGASLITINANKEVVITAGVLNTPK
LLELSVIGSEEILQKYNIPVVIHNPNVIDGVVTGDPLLRQEPEAIQPAMQMYSEHEPGPM
TIGGVQSNALMPILEFTGADGQKAQKKFFDQFLSTEPATSFQSVIRGIFETHNEATCDMF
TFLAQANLHQTNTSYYVGPSSSPENYLSLGQTIDPRYFSHPLDIEILARNLLELERLHQN
EALAKYFKMSDGRRNHLDSFLTDLELAEKYFRDTVTTSHHFAGTATMLPEDKGVSIFPII
PPANRTATVYAVAERAADIIKADA

Enzyme Prediction     

No EC number prediction in EEQ85274.2.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	101	383	2.8e-36	0.5492957746478874

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.11e-25	2	384	87	537	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	8.82e-23	2	381	88	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	1.55e-12	273	376	20	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS68114.1|AA3_2	7.32e-185	1	384	89	604
QSS60310.1|AA3_2	2.96e-184	1	384	89	604
QSS49637.1|AA3_2	2.40e-183	1	384	89	604
BCS02826.1|AA3_2	1.58e-125	1	381	91	599
BCS14479.1|AA3_2	1.58e-125	1	381	91	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	4.06e-12	1	383	82	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.00e-11	1	383	83	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	2.28e-10	1	381	83	583	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
6O9N_A	2.39e-10	1	380	117	638	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]
4YNT_A	3.81e-09	2	384	86	568	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	1.62e-16	1	383	94	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	1.62e-16	1	383	94	611	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	2.96e-15	1	383	94	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	7.16e-15	1	383	126	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.24e-14	1	384	123	611	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999761	0.000305

TMHMM  Annotations     

There is no transmembrane helices in EEQ85274.2.