CAZyme Information: EEQ35865.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ35865.1
• CAZy Family: GT71
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
912		101676.82	6.5111

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995709:590046-593218(+)

Full Sequence      

MFWRRSKTSNQEPAAPAPSSRQSGLSSVPEPSSRPISQSGSQTPIGIDDDAKYRAIIKYL
HARLATSKWCPPPSDPSSEYHGLLLRKSRGAYISEPDLVHPLLLGAVQKINVAVAFTMAT
EITRIIFSILQLDQTELVLPSGFQVQVVASLAEIACSPSSAVKKFQYVALVREERLLLVW
HDELEKILVHAEDVEEKLLAFICGTRISVFSPSQSAGYSLPHSSIGSPAASTRNFVPLWN
KEASGLASTPLRVPDEEAAKPIESLDRPLALTSSIFVGLGMCLIVVLLVGFGISNLILQS
LVDGSWIRFALVASLPIFMLFSVFFVIVIFSDIFQAIGPIKTLKTNSRFYSPVRPDLSHA
YAMGFKPPRITIQLPVYTESLAGVIIPTVTSLKAAISYYESHGGTATIFVNDDGLAYLTE
EQREERISFYHDNNIGWVSRPKNNEDGYIRKGRFKKASNMNFALNVSNKVEDRLLDLLSE
TLETTEMIDASQEEAYYKIALQEVLASDSRIRAAGDIRIGEAILIVDADTRVPVDCLLYG
AAEMFLSPEVAIIQHSTGVMQVVGDYFENGITFFTNLIYSSIRFAVGSGETAPFVGHNAF
LRWKAVQSVGKPDDGYVAYWSESHVSEDFDIALRLQIAGDIVRLASYHGDEFKEGVSLTI
YDELARWEKYAYGCNELVFNPIYTWIYKGPFTKLFMTFLWCNMQLSSKITILGYISSCKP
VPNLISRYYALASGFPLTILNYFLVGWFNGYLDKFYIESWKVLLSLIVIFSLLGNVTLAI
IRSRLSEKSLWSALIENFKWMPMMAIFFGGVSFHLSLAILSHMLSIKMEWGATAKEKVDS
NFFKEVPKIFKSFKWLYVILLPLLAGMIYLGNFAPRGWEITEVAAVVPMAVTLSLHALLP
LLLNPSLMIFNY

Enzyme Prediction     

No EC number prediction in EEQ35865.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	523	735	1.6e-54	0.9137055837563451

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	5.02e-53	523	737	2	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
133045	CESA_like	1.35e-09	372	628	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
224136	BcsA	2.50e-08	520	807	138	403	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
224137	GT2	3.87e-05	521	735	86	301	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
133043	CESA_CelA_like	7.36e-05	368	643	1	201	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA18667.1|GT0	0.0	47	912	56	919
CAE7220538.1|GT0	0.0	18	912	18	907
QRD03074.1|GT0	0.0	47	912	3	858
CBX97842.1|GT0	0.0	43	912	49	904
UNI18966.1|GT0	6.32e-318	31	912	24	905

PDB Hits     

EEQ35865.1 has no PDB hit.

Swiss-Prot Hits     

EEQ35865.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

Start	End
275	297
309	331
728	750
762	781
804	826
853	875
885	907