CAZyme Information: EEQ35760.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ35760.1
• CAZy Family: GT66
• CAZyme Description: conserved hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263	DS995709|CGC1	28856.60	7.2050

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995709:306803-307948(+)

Full Sequence      

MVSFNALFVAGVLASSVIAAPVKGGKRGMAYNDPQAVAAFKGTRAFSWAYNWGSSSGNIL
GGIDYTPMLWGQKFFGQWAESTPSILSTGCKYVLSFNEPDIPSQANMSPQDAVQAHKQYM
KPFVGKASIGSPAVSNGGGEMGLSWLGKFLDGCAGQCNIDFLNVHWYDSAQNVAAFKKHI
TDSVNLAHSHGIDKIWLTEFRGDGDENSQVQFLHEVLPWLDSNAGVARYSYFMADDLVKG
AWAFTRLRFLAFWFHQVHTKDPH

Enzyme Prediction     

EC	3.2.1.39:1	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	40	237	1.5e-61	0.8794642857142857

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	1.26e-64	30	247	1	221	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEQ35760.1|GH128	1.21e-199	1	263	1	263
OAT07255.1|GH128|3.2.1.39|3.2.1.-	2.15e-83	1	240	1	249
QSS66195.1|GH128	6.98e-80	1	240	1	251
QSS57615.1|GH128	6.98e-80	1	240	1	251
QSS67360.1|GH128	5.65e-79	1	240	1	251

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UAY_A	3.83e-82	18	240	27	248	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UB0_A	3.96e-82	25	240	3	217	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAX_A	8.66e-17	24	232	93	316	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	4.22e-16	24	232	23	235	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]
6UFL_A	1.10e-15	24	232	23	235	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) in the complex with laminarihexaose [Amycolatopsis mediterranei],6UFZ_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase (E199Q mutant) from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	1.66e-19	44	240	316	507	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000371	0.999595	CS pos: 27-28. Pr: 0.5392

TMHMM  Annotations     

There is no transmembrane helices in EEQ35760.1.