CAZyme Information: EEQ35624.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ35624.1
• CAZy Family: GT57
• CAZyme Description: symbiotic chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1011	DS995708|CGC6	109973.61	6.2887

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995708:1353563-1357934(-)

Full Sequence      

MRALAQLHIVAALAVGFLPFGLSQTCSETQKCKSGCCSKFGSCGFGPDFCSDDVCISSCD
AKAECGKYAPEGKEHCPLNVCCSKFGQVSLSTLHAEEPQAVADMLATTVVETFKIKAMHS
RDSDFYKKFVNLKQKAHSVKTSLAVGGWDVGGKAFSDMARFPGSRKAFINSAVDLIKSYG
FDGIDIDWEYPAADDRGYLRGFDLPGMAKYVDWFNFMSYDIHGVWDGDSPFTSRVIAPHT
NLTEISSGLDLLWRNSISPSQVSLGLGFYGRSFTLANPSCTVPGCPFAGSGGGTGGGEPG
SCTGVSGTLSNYEIERILHHLSPNRVYDEEAGVNWMSWKLNQWVSFDDTRSLRRKADFAN
QHCLGGLMAWSVDLGGPGTLGNPNSFDPQSTEIGGASLDGRGITDGGSGEVFISPDIYRE
PRPVINCYPPCTFILPPFILNNTVTISLPPWTTSLAVGWTTTSTTTLPGGSVSTSTGFTT
VIQTTTLTIPPITTTAVDVWNYIITDTEIITPTVQLTRSIIPPPLTITNNPNPEITVKPG
PPGPLCKSGCGTKCHIFCNGLCWPSCSGKGSSGGDGFFDPNDPNRPRTPDPDNPDSPDDT
KKDPCDPDFDSSSGLCPTGNFPIWDPSTRMVRCDVPNSMVNSQKSPCQKMIDDNFDENRQ
KLEAAKQCCPNGAGSSLFGRRADATCSTTPLTEYFETTPPDNGKCHATFTCDYAEWPNVC
ANARSAIEKRGKTSILTAGVRRNIEVTHPWYHGKFQSGEGLQRGSPLAGWQLKGNIYALL
KASDSECSANTDIDCNVEEYPFSSGDPLKEPKLDVWEEQAVLRLVPKSENSAHALALRNF
YFDSANAIGEKSYTGLKYWNAFLLINGAKMRKGERRWDPWWDDKLFDHTIRPGIKTTNVP
SQYCDHPSPGKKTHIGGVWTTVDDRGITVGEPLDRLPSASYSCDDYPGYIHSIKRSVRGR
RSRKGSQVGGSPLSRISTTKNTNSTEAAQTWMMMTRVPEMQTVPQIQTSVM

Enzyme Prediction     

EC	3.2.1.14:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	124	373	3.5e-49	0.777027027027027

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214753	Glyco_18	4.16e-61	122	374	50	333	Glyco_18 domain.
119351	GH18_chitolectin_chitotriosidase	2.74e-60	122	374	54	340	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
395573	Glyco_hydro_18	6.59e-58	119	373	43	305	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.02e-48	82	373	37	320	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119357	GH18_zymocin_alpha	2.25e-42	108	375	37	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62098.1|CBM18|GH18	4.21e-181	25	530	38	624
QSS71211.1|GH18	1.62e-157	118	530	1	446
CAP74296.1|CBM18|GH18	1.28e-146	2	567	8	698
BAE65677.1|GH18	1.12e-126	78	566	7	579
BCS04473.1|CBM18|CBM50|GH18	9.69e-99	6	528	8	603

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUS_A	3.30e-39	98	374	23	341	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
5WVF_A	3.61e-38	98	374	23	341	Crystal structure of a mutant insect group III chitinase (CAD2-E647L) from Ostrinia furnacalis [Ostrinia furnacalis],5WVG_A Crystal structure of a mutant insect group III chitinase complex with (GlcNAc)5 (CAD1-E647L-(GlcNAc)5) from Ostrinia furnacalis [Ostrinia furnacalis]
5XEP_A	8.73e-38	98	393	43	376	Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus],5XEP_B Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus],5XEP_C Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus],5XEP_D Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus],5XEP_E Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus],5XEP_F Crystal structure of BRP39, a chitinase-like protein, at 2.6 Angstorm resolution [Mus musculus]
5Y29_A	1.22e-36	98	374	28	350	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	1.56e-36	98	374	28	350	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q61362|CH3L1_MOUSE	4.39e-36	98	393	51	384	Chitinase-3-like protein 1 OS=Mus musculus OX=10090 GN=Chi3l1 PE=1 SV=3
sp|Q6TMG6|CH3L1_SHEEP	6.83e-35	98	374	22	334	Chitinase-3-like protein 1 OS=Ovis aries OX=9940 GN=CHI3L1 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	1.08e-34	98	374	43	362	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|Q91XA9|CHIA_MOUSE	1.20e-34	97	421	42	403	Acidic mammalian chitinase OS=Mus musculus OX=10090 GN=Chia PE=1 SV=2
sp|P30922|CH3L1_BOVIN	1.97e-34	98	374	43	356	Chitinase-3-like protein 1 OS=Bos taurus OX=9913 GN=CHI3L1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000224	0.999739	CS pos: 23-24. Pr: 0.9794

TMHMM  Annotations     

There is no transmembrane helices in EEQ35624.1.