CAZyme Information: EEQ35110.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ35110.1
• CAZy Family: GT35
• CAZyme Description: fibronectin

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
307	DS995707|CGC1	33570.04	6.2159

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995707:1930177-1931100(+)

Full Sequence      

MERATANILLLFVFLYALVSSSSAAPPPWPGTSQYQDRTNGIAASIDHGLVARQPGLRVM
FVGDSMTQGKHGDCTWRYRMWQWFQNQGVAVTFVGPYTGTVEPDQPAPPYGSSATPVAPI
KTSGGYALDVSPDFDRHHFAVWGRAAAISKDLIHDVLSAHPADMMLLMLGFNDLGWLFSQ
PIDALGSLYALINNARKANPNLKFAIANVPQRSFIGREDLPVTTQQYNSLLRDALPQWST
EQSPIHLVELQENYSCGMAACEAGYDGLHPNAQGEYQIAHAFTLTLVNDFKIGSSPLMVP
LNSRGGF

Enzyme Prediction     

No EC number prediction in EEQ35110.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE3	57	283	2.7e-50	0.979381443298969

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238871	XynB_like	5.95e-38	135	286	14	157	SGNH_hydrolase subfamily, similar to Ruminococcus flavefaciens XynB. Most likely a secreted hydrolase with xylanase activity. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
404371	Lipase_GDSL_2	1.39e-06	154	278	54	176	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	6.41e-06	110	278	12	179	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
225353	TesA	7.47e-04	146	281	54	203	Lysophospholipase L1 or related esterase [Amino acid transport and metabolism].
238866	sialate_O-acetylesterase_like2	0.004	133	277	18	158	sialate_O-acetylesterase_like subfamily of the SGNH-hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39824.1|CE0	5.17e-112	57	302	139	383
BAE63679.1|CE0	5.08e-106	48	305	50	310
BAE60780.1|CE0	5.28e-85	106	300	19	215
UKZ09962.1|CE0	1.76e-76	57	300	512	762
SCG40251.1|CE0	2.31e-76	57	300	336	584

PDB Hits     

EEQ35110.1 has no PDB hit.

Swiss-Prot Hits     

EEQ35110.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000201	0.999757	CS pos: 24-25. Pr: 0.9751

TMHMM  Annotations     

Start	End
7	29