CAZyme Information: EEQ34241.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ34241.1
• CAZy Family: GT22
• CAZyme Description: glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
866	DS995706|CGC6	98252.12	6.0091

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995706:2478291-2481383(-)

Full Sequence      

MAPGIETSHQPRERRPSVEEIRTLRLTANTTATATAAATAATTDISVGPQGVWQQGRLRE
VVRHVETSLARSIFNCDEVRAAYSATALAFRDRLVVEWNRTQQRQTFKDQKRVYYLSLEF
LMGRALDNAMLNVGLKDLARDGLHDLGFRVEDIIKQENDAALGNGGLGRLAACFLDSLAS
LNYPAWGYGLRYRYGIFKQEIVNGYQIEVPDYWLDFNPWEFPRHDVVVDIQFYGWVRKYQ
DENGKTVHSWQDGEIVQAVAYDMPIPGYQTPTTNNLRLWSSKAASGEFDFQRFNAGDYES
AVADEQRAETISAVLYPNDNLDRGKELRLKQQYFWCAASLFDIVRRYKKTKRPWSEFSDQ
VAIQLNDTHPTLAIVELQRIFIDEEGLEWDEAWRLVSNTFGYTNHTVLPEALEKWSVPLM
QNLLPRHLQIIYEINMAFLQHVERKFPKDHDLLSRVSVIEETQPKMVRMAHIAIIGSHKV
NGVAELHSDLIQSTIFKDFVTIYGPDKFGNVTNGITPRRWLHQANRRLSDLIASKLGGHE
FLKNLTLLDKLEGFLDDKEFKTEWAAIKTANKERLAKHILDTTSVRVNPKALFDIQVKRF
HEYKRQQLNILGVIHRYLRIKAMSPEERSKLAPRVSIFGGKAAPGYWMAKTIIHLINSVG
AVVNNDPDVGDLLKVIFIEDYNVSKAEIICPASDISEHISTAGTEASGTSNMKFVLNGGL
IIGTCDGANIEITREIGEHNIFLFGNLAEDVEELRHAHVYNPSSITLDPSLSAVFDAIRA
NTFGDASSFSAIIDSITQHGDYYLVSDDFNSYIKTHDIIDEAFKDKDGWVEKSIQSVARM
GFFSSDRAIAEYAEGIWNIEPLDVSN

Enzyme Prediction     

EC	2.4.1.1:158

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	143	860	8.6e-280	0.9970326409495549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184948	PRK14986	0.0	84	862	43	813	glycogen phosphorylase; Provisional
223136	GlgP	0.0	59	861	11	750	Glucan phosphorylase [Carbohydrate transport and metabolism].
237881	PRK14985	0.0	104	857	52	794	maltodextrin phosphorylase; Provisional
273967	P_ylase	0.0	61	859	1	794	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
340853	GT35_Glycogen_Phosphorylase	0.0	59	859	2	795	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS74747.1|GT35	0.0	59	863	75	877
QSS54596.1|GT35	0.0	59	863	75	877
EAA65583.1|GT35	0.0	60	864	19	820
CAF32007.1|GT35	0.0	59	864	29	849
CAD28434.1|GT35	0.0	59	864	29	849

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1YGP_A	0.0	62	862	49	878	Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae],1YGP_B Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site. [Saccharomyces cerevisiae]
4BQE_A	2.43e-275	61	864	67	873	Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQE_B Arabidopsis thaliana Cytosolic Alpha-1,4-glucan Phosphorylase (PHS2) [Arabidopsis thaliana],4BQF_A Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQF_B Arabidopsis thaliana cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with acarbose [Arabidopsis thaliana],4BQI_A ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana],4BQI_B ARABIDOPSIS THALIANA cytosolic alpha-1,4-glucan phosphorylase (PHS2) in complex with maltotriose [Arabidopsis thaliana]
3CEH_A	3.24e-264	63	863	11	809	Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEH_B Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688 [Homo sapiens],3CEJ_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEJ_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE2865 [Homo sapiens],3CEM_A Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens],3CEM_B Human glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE9423 [Homo sapiens]
1FA9_A	8.01e-264	63	864	33	832	HUMAN LIVER GLYCOGEN PHOSPHORYLASE A COMPLEXED WITH AMP [Homo sapiens]
1FC0_A	8.01e-264	63	864	33	832	HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],1FC0_B HUMAN LIVER GLYCOGEN PHOSPHORYLASE COMPLEXED WITH N-ACETYL-BETA-D-GLUCOPYRANOSYLAMINE [Homo sapiens],2ATI_A Glycogen Phosphorylase Inhibitors [Homo sapiens],2ATI_B Glycogen Phosphorylase Inhibitors [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06738|PHSG_YEAST	0.0	62	862	72	901	Glycogen phosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPH1 PE=1 SV=4
sp|Q00766|PHS1_DICDI	4.36e-311	59	864	46	845	Glycogen phosphorylase 1 OS=Dictyostelium discoideum OX=44689 GN=glpV PE=1 SV=3
sp|P34114|PHS2_DICDI	1.37e-293	59	866	116	920	Glycogen phosphorylase 2 OS=Dictyostelium discoideum OX=44689 GN=glpD PE=1 SV=2
sp|Q9SD76|PHS2_ARATH	4.08e-275	61	864	34	840	Alpha-glucan phosphorylase 2, cytosolic OS=Arabidopsis thaliana OX=3702 GN=PHS2 PE=1 SV=1
sp|P32811|PHSH_SOLTU	7.39e-275	64	859	33	832	Alpha-glucan phosphorylase, H isozyme OS=Solanum tuberosum OX=4113 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000008

TMHMM  Annotations     

There is no transmembrane helices in EEQ34241.1.