CAZyme Information: EEQ34173.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ34173.1
• CAZy Family: GT22
• CAZyme Description: mannosyl phosphorylinositol ceramide synthase SUR1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356	DS995706|CGC7	41724.31	9.4857

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995706:2294610-2295680(-)

Full Sequence      

MSLVSYLFGKRRQLRNISLYLFNFIWNAPILVLAALLFLYIFASSIYSYNFLNSALNKNS
LSLDNLPQGYVKALEDAISKNQPTYNVTILKDDLATPIPRIIHRTYSSPEFPEIWQTAFN
SCQVLLPEYKHYFWTDQKARDFIETNFKWFLATYDGYRYNIQRVDALRYFLLWHYGGIYM
DMDIGCRRDIRPLLDFPAWVPRTWPYGVSNDLMASSPGHPLMIKAALSLHDHNQWYISKY
ITVFFTTGPMFLSGIIASWFHILKTDGKDDFATFKGPHGLAILPSRLYDTTEYTFFSHFP
GSTWHGNDVAVLSWLYHYLWMFFLAGFALMIMSVVLGPTRRSKRRMPRFMTKHELV

Enzyme Prediction     

No EC number prediction in EEQ34173.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	114	194	2.9e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.76e-49	30	329	14	305	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	7.83e-19	112	195	1	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE56144.1|GT32	9.42e-119	21	345	18	339
QRD88228.1|GT32	1.33e-118	21	345	18	339
QMW37845.1|GT32	1.33e-118	21	345	18	339
QMW25762.1|GT32	1.33e-118	21	345	18	339
UCK58225.1|GT32	2.40e-113	57	345	30	315

PDB Hits     

EEQ34173.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10323|IMT3_SCHPO	4.06e-61	80	344	40	300	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	3.40e-56	72	351	52	329	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	4.70e-56	84	344	45	305	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|P33300|SUR1_YEAST	8.82e-56	84	327	34	274	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	3.47e-48	98	327	62	282	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999861	0.000155

TMHMM  Annotations     

Start	End
20	42
241	263
314	336