CAZyme Information: EEQ33606.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ33606.1
• CAZy Family: GT2
• CAZyme Description: mannosyltransferase complex component

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
323	DS995706|CGC5	36306.83	8.7989

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995706:805303-806438(-)

Full Sequence      

MQFALPPRKTSRPPIYSRSSPTALRRRQLKSCAVISCIVVSILFLVFHLFSSGTPSVDTP
VADGPPVVIVTVLDTELFSDTYIQRIKQNREDYAKRHGYINFFANTADYVPVMNLPSGTV
VPRSWALVPAMRHAMTKYPGSTYFFHLSPHSVIMDPSISLVSHVLEKSKLESLMIKDAPV
VPPDSVIKTFTHLSGKDVDLVITQDAENLCPGSFIIKRGQWANYFLDAWFDPLYRSYNFA
KAENHALDHIVQWHPTILARLALIPQKMINAYSHEAPKPGANGLYTEGDFIVRLGGCEST
PSRSCEREMEPYWSKWAKANAHV

Enzyme Prediction     

No EC number prediction in EEQ33606.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	65	301	4.3e-69	0.9715447154471545

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	8.74e-68	63	305	1	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS60522.1|GT34	2.96e-138	1	318	1	318
QSS49429.1|GT34	1.13e-135	1	318	1	318
QSS67872.1|GT34	2.28e-135	1	318	1	318
AAY62606.1|GT34	1.30e-130	1	318	1	313
CAK38855.1|GT34	1.22e-128	1	317	1	312

PDB Hits     

EEQ33606.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13640|YGWH_SCHPO	8.57e-39	79	315	85	309	Uncharacterized alpha-1,2-galactosyltransferase C8D2.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pi048 PE=3 SV=2
sp|O94622|YBKD_SCHPO	4.93e-34	82	312	123	346	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	9.57e-31	82	297	123	333	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|P46985|MNN11_YEAST	2.56e-29	43	319	136	422	Probable alpha-1,6-mannosyltransferase MNN11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN11 PE=1 SV=2
sp|Q10359|GMH3_SCHPO	1.20e-27	80	297	106	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999968	0.000029

TMHMM  Annotations     

Start	End
32	51