CAZyme Information: EEQ33387.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ33387.1
• CAZy Family: GT2
• CAZyme Description: chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1267		139403.49	5.4518

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995706:206599-211976(-)

Full Sequence      

MVRLSLGLPLAGLLTSTFATVTLPMRDLPPLSGQTCPESCHEAGYMPSNWTVVAEFDQLK
ACPRPILMDFSLDIPVSEKQIIRTCDTWGTYYYYTPAPSFGIPSENEQDHVIPHLALSAA
GNNSQGMRARYQAVTAVKKIQSHLQRSAEWNRTILFGAFGGATVGVYIGENMQNPSVADS
LLKPFMEKIMSVGIESSKAALLQVCGNNRTGDNTFGIIAASNKGLSTAQAAVKQWANATC
VDTSSYTESSTLNGTVIRIHKPVPVLVPSNTTTTNLTTRAIHMPILNARGDCRAIGVISG
DSCGALATRCGISPSDFTKYNNNPKLCSSLTPGQHVCCSSGTLPDFRPKPNSDGSCAVYE
TKSGDNCATIAAANSLKKEDLETLNKRTWGWAGCDSLWVGVKMCLSKGDPPMPAPIANAI
CGPQKPGTPIPPKGANISELNPCPLNTCCNIWGQCGTTEDFCIDTRGDGAPGTAKKGTYG
CISNCGMDIVKGDPPAQFIKLGYFEAFNLGRECLNMDVRQIDSSYTHVHFAFAVLTDDFE
VYLEDEYQKYQFEQFKKIRSFKRILSFGGWAFSAELPHYQVFRNGVKTANREKLASNIAK
FINDNGLDGVDIDWEYPGAPDIPGIPPPDDAYEGIAYAAFLSILKSKLNSGKSLSIAAPA
SYWYLKQFPIKGISRIVDYIVYMTYDLHGQWDSGTLFNAEIREIATGSISPRSLSHGNDS
SVEIRDISASANTWYDKDSDSNIMTYGDNWVAYMVESVRARRANIYKGYNMGGTTNWAVD
LDKFQDPPSLIEGSDVKLSWQQIKQNIKKTGDAAACDKESRTGTWVTLDNCSPDAKCDPH
HSSSDKKEDWTGACSYLVWNSFAQVHVLIKNYQYSLKEAAIQVQNKKNEFVDTFAPEGHR
PDVPLWLNTLLTVLLIPSTTLGTAFWKGALRNLAFFQTRPLRLDLLKDTSQALVSAGYTI
SKSFIEKETVKEVTFNTLYDSLIGKWTEQIDTLVKELFDGSDEHIKQLSKIIMDGKMIEG
KHDAVPDPDADHTASFLEQKLAERAFYAAAIPNVWKMRQPYASYPVILDFGPDCNRDIGS
DQYFKSGQDYNQGWICLDGHNYILASTFERDNDGPNCSPEYYDWCNNIDQRFLFSLPGLD
KIRKPDPKFGKVTVEDLVAGSVNTWKRAGKLNIIDGSPGGVNPVNKDDFVDLWDNDIRAP
GMIRIPVCSVEEASFLAQDGTGHGLPDGDRPSFPCLRDPNKSMSEGDLDYIFKAVGMSEA
NPYPMAP

Enzyme Prediction     

EC	3.2.1.14:3	3.2.1.14:3	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	502	789	4.5e-35	0.9459459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	6.69e-116	500	782	2	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	1.20e-40	500	830	2	307	Glyco_18 domain.
395573	Glyco_hydro_18	4.98e-39	502	782	4	307	Glycosyl hydrolases family 18.
119365	GH18_chitinase	8.01e-35	523	782	24	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119349	GH18_chitinase-like	4.93e-30	502	687	3	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ65053.1|CBM18|CBM50|GH18	1.42e-301	23	1235	40	1476
AEO70565.1|CBM18|CBM50|GH18	3.40e-253	36	1240	43	1364
AEO62937.1|CBM18|CBM50|GH18	7.06e-248	11	1213	7	1328
AEO69851.1|CBM18|CBM50|GH18	3.28e-246	36	1235	33	1366
ATY61718.1|CBM18|GH18	5.02e-246	36	1235	43	1351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Y29_A	1.03e-14	526	786	37	355	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
5Y2A_A	1.08e-14	526	830	33	314	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 2 [Ostrinia furnacalis],5Y2A_B Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 2 [Ostrinia furnacalis]
6JAV_A	1.14e-14	526	786	37	355	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
5Y2C_A	1.08e-13	526	830	33	314	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 2 E2180L mutant in complex with PENTA-N-ACETYLCHITOOCTAOSE (NAG)5 [Ostrinia furnacalis],5Y2C_B Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 2 E2180L mutant in complex with PENTA-N-ACETYLCHITOOCTAOSE (NAG)5 [Ostrinia furnacalis]
6BT9_A	1.66e-13	562	701	159	298	Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	3.29e-80	166	786	89	716	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|Q13231|CHIT1_HUMAN	2.09e-12	526	701	52	228	Chitotriosidase-1 OS=Homo sapiens OX=9606 GN=CHIT1 PE=1 SV=1
sp|P32470|CHI1_APHAL	7.01e-12	523	701	62	255	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|O14456|CHI1_METAN	1.64e-11	556	716	118	271	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1
sp|E9ERT9|CHI1_METRA	3.83e-11	488	701	29	256	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000328	0.999654	CS pos: 19-20. Pr: 0.9740

TMHMM  Annotations     

There is no transmembrane helices in EEQ33387.1.