CAZyme Information: EEQ32645.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ32645.1
• CAZy Family: GH5
• CAZyme Description: MIPC synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
357		41394.64	9.2630

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995705:1039148-1040432(-)

Full Sequence      

MRRGLLIFLLINTAIILFLVRSVFTLLTLLVEDATDDAIQNVELPGVNSSLIDLRPQLIP
KIIHQTYKNESIPEIWVGPRNRCIEMHPDYEYMLWTDAKSREFISEHYPWFLTTFDNYPF
PIQRADSIRYFILAHYGGTYIDLDDGCNRRLDPLLSYPAWVRRTAPTGISNDAMGSVPNH
PFFLRVIKSLQAYDRAWVLPYITVMYSTGPLFLSVIWKEYKNTDPDGVNRVRVLLQDAYN
RHSWSFFTHHPGSSWHGEDAQLIFWMGSHWMLITFSGFLAAGIVGLALWRIYRRVLSIGS
KHARYTPLASGTSSPRRSMSPSRRKMRILPLFFQRPHAKKEDEEIGPDSPFELGNRQ

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	81	155	1.1e-21	0.8777777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.01e-77	57	285	80	310	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.99e-25	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS17906.1|GT32	2.26e-175	1	356	1	354
BCS14035.1|GT32	5.08e-175	1	357	1	358
BCS02358.1|GT32	5.08e-175	1	357	1	358
CAP86500.1|GT32	7.47e-175	1	356	1	358
CAK42232.1|GT32	2.06e-174	1	357	1	358

PDB Hits     

EEQ32645.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	3.58e-103	1	279	1	283	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|P33300|SUR1_YEAST	8.67e-103	12	279	12	275	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.26e-90	48	284	46	283	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	4.06e-89	58	278	81	304	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|O14084|IMT1_SCHPO	5.12e-59	28	308	45	317	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.556274	0.443726

TMHMM  Annotations     

Start	End
5	27
195	217
270	292