CAZyme Information: EEQ31413.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ31413.1
• CAZy Family: GH2
• CAZyme Description: cell wall synthesis protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	DS995704|CGC4	37078.26	5.0034

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995704:673144-674236(+)

Full Sequence      

MKFLSSAILTLAVTGSVQASRHVHGHGHRHARHLEKREITQAAGSTVVVFVLDGQEISKD
KACDGIKAGTLLWSDGGDHKDICSGAPQAPAPGPAGNQFYEAPPSQPAPPPPSETSPPKG
HTESTPKNEEPKEPNEPEEPKEPEDPEDPELPDGEGADLEFPDGKIPCSEFPSKYGAISL
DYLGLGGWSGIQFPEDVGSGYGNIRTAISGQGCEEGAMCSYACSAGKQKTQWPSRQGAKG
ESVGGLECRNGKLPLTNPTLSNKLCMSGVGGVYVKNHLSVSVAVCRTDYPGTEEESIPLD
AKSGATSPLTCPKAEDYYTWKGMHTSAQYYVNPAGASTMVTSLLSTWVLAR

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH132	135	338	6.1e-68	0.6336633663366337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397780	SUN	4.42e-87	163	338	1	164	Beta-glucosidase (SUN family). Members of this family include Nca3, Sun4 and Sim1. This is a family of yeast proteins, involved in a diverse set of functions (DNA replication, aging, mitochondrial biogenesis and cell septation). BGLA from Candida wickerhamii has been characterized as a Beta-glucosidase EC:3.2.1.21.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS61249.1|GH132	5.43e-93	47	337	50	329
QSS57189.1|GH132	4.34e-92	47	337	50	329
QSS72024.1|GH132	8.67e-92	47	337	50	329
BAE55477.1|GH132	3.86e-91	1	338	1	324
QMW38532.1|GH132	1.27e-89	1	338	1	325

PDB Hits     

EEQ31413.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AM57|SUN41_ARTBC	2.63e-91	1	335	1	352	Probable secreted beta-glucosidase ARB_04747 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_04747 PE=1 SV=1
sp|Q4WGL5|SUN1_ASPFU	3.41e-83	1	337	1	322	Secreted beta-glucosidase sun1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=sun1 PE=1 SV=1
sp|O43015|YBOH_SCHPO	4.51e-51	158	337	56	226	Probable secreted beta-glucosidase C2G2.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2G2.17c PE=3 SV=1
sp|P40472|SIM1_YEAST	4.32e-50	151	337	209	383	Probable secreted beta-glucosidase SIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIM1 PE=1 SV=2
sp|B3LRC2|UTH1_YEAS1	5.24e-50	160	337	105	270	Probable secreted beta-glucosidase UTH1 OS=Saccharomyces cerevisiae (strain RM11-1a) OX=285006 GN=UTH1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000345	0.999610	CS pos: 19-20. Pr: 0.9748

TMHMM  Annotations     

There is no transmembrane helices in EEQ31413.1.