CAZyme Information: EEQ30486.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ30486.1
• CAZy Family: GH18
• CAZyme Description: mannosyl-oligosaccharide 1,2-alpha-mannosidase IC

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864		95803.41	6.1621

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995703:1212942-1215616(-)

Full Sequence      

MFRFRRYRVYLIFSIISILAIIHFSGLSSSSSYAPSVPVLKPGRPQSQPGQPQPPARGEE
KQQKPIPPPAPPKPENGQGLLPGAKAVTSTVVNAAKETPPAAIPLPSPVDDIPNSQIIEP
EGKGRQEVEEEEEEEDKGESNRARWEKQPEHFPVASTDVIPLPTGTPKKLPKIQFDFPAE
SAQAKESREQRLTQIKSSLKHSWDGYRKRAWTHDEVRPQSGGFRDPFMGWGATLVDSLDT
LWIAGMKEEFEEAVRAVGKIDFKTSKRNDIPLFETVIRYLGGLIGAYDISDGQYRTLLDK
AIELAEILMGAFDTPNRMPVTYYMWAPQFASQRHRSGTRVVLAELGSLSVEFTRLAQITE
NNRYYDAIARITNALEKWQPDTSIPGLWPSFLDASGCKEVKKNKKNKNKKPVEQSPDSPR
SIPQANGHQKRDKSEPDGESLLPGEEPANYGGGASLPSINTAPPSKLNMPSKPAQHQDAG
FDGDCEDQGLTYPPGVLSATYTLASLADSTYEYLPKTYALLGGLNEQYKNMYKQARDATM
KYVAFRPMLPDSKDILFIADVTTSLMEGDDSDFRYNYHPSHLGCFVGGMFGVGSKLFGLD
QDLEIAAKMADACVWAYNATTSHIMPEGFTVLPCKDIKECEWNQTAYNHAVYPYTVNKSG
KESLTVRKGGKKAGINPTATHRPEALPTAPYPDKQKMGRHQKMQSPTGAGGIIAKRMDAA
ETPIPDRIVADLSKPVPGGAAVATSTAMSHAQLADMHIRDERIPPGMTKITSSKYILRPE
AIESVFIMYRITGDEAWREKGWDMFKAIERATKTQFGSSAIDDVTSNEPIFQDEMESFWL
GETLKYFYLLFSDPDVVSLDDYVL

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	199	864	5.4e-163	0.9753363228699552

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	200	864	3	444	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.23e-87	153	864	34	509	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS63392.1|GH47	9.13e-266	89	864	110	851
QSS69163.1|GH47	9.82e-262	89	864	106	848
QSS51165.1|GH47	3.61e-259	118	864	135	848
QKX63570.1|GH47	4.13e-235	141	864	165	887
QGA16383.1|GH47	4.52e-223	145	864	176	910

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2RI8_A	2.79e-37	195	853	9	448	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	3.59e-37	186	853	35	483	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
5KIJ_A	1.56e-36	201	863	15	441	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
5KK7_A	1.64e-36	201	863	15	441	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1FMI_A	1.72e-36	201	863	20	446	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0D076|MNS1B_ASPTN	9.74e-37	151	852	2	481	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|P31723|MAN12_PENCI	1.84e-36	186	853	35	483	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Penicillium citrinum OX=5077 GN=MSDC PE=1 SV=2
sp|Q9NR34|MA1C1_HUMAN	3.08e-36	137	863	106	607	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
sp|P39098|MA1A2_MOUSE	1.08e-35	195	863	184	616	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|Q2ULB2|MNS1B_ASPOR	2.63e-35	151	855	2	484	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000003	0.000025

TMHMM  Annotations     

Start	End
7	26