CAZyme Information: EEQ30320.1

Basic Information

• Species: Microsporum canis
• Lineage: Ascomycota; Eurotiomycetes; ; Arthrodermataceae; Microsporum; Microsporum canis
• CAZyme ID: EEQ30320.1
• CAZy Family: GH16
• CAZyme Description: glucosidase I

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
811	DS995703|CGC12	92274.96	4.9099

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_McanisCBS113480	8847	554155	82	8765

• Gene Location: location=DS995703:792663-795481(+)

Full Sequence      

MGVVSSFSWVCILSALASYSQNGALAAAEDTAALAVDTVLNQTLLWGPYRPNLYFGVRPR
IPKSLLMGLLWAKVDDYSTAQDNFRHTCEQNEGMEGYGWEEYDIRKGGRQTIHDSRNTID
LTIDFIKVPGGDNGGSWGARIKGVPRPDAAPDQPSTVIFYAGMEGMGNLGLSNEPNELGY
EGDVRLAGKTMSLGDFTIDITRGPDTNAYPERVHPSYDEKPLDRTIVSSMNVRPEALWQG
KTILFTQMKQAIDAMLQKFGDKNPPPPPALFTLPNAQQGDNIHYVQKVFRGAFEFDILFS
SGTAEKPLTPSTITEQIKDVSASFSQKFEEIFKPLAPFNTPEYLKFSKAMLSNLVGGIGY
FYGDSIVDRTHAPEYDEESEGFWEDAAEARARAQLTPTDPSELFTSIPSRPFFPRGFLWD
EGFHLLPVIEWDLDLTLQIVKSWLNLMDEDGWIAREQILGPEARSKVPHEFQTQYPHYAN
PPTLFLVLTEFMNKAALGKSSDLHGSNSNYSDNKELSKSFLRSIYPLLRRHYFWFRKTQW
GDLKSYERESFSTKEGYRWRGRTVEHILTSGLDDYPRPQPPHPGELHVDLISWMGMMTRS
LRGIAETLEETADVEEYTKYEIAILRNVDDLHWDKDANTYCDATIDDYEESVHVCHKGYI
SIFPFMTGLMDANHPRLGDILNLIQDPDELWSDYGIRSLSKKDEFFGTGENYWKGPIWIN
MNYLVIKNLLSIAQVPGPYQDQAREMYTKLRRNVVDNVFKEWKRTGFAWEQYNPDTGKGQ
RTQHFTGWTSLVVKMMVMPDLNAKPSAKDEL

Enzyme Prediction     

EC	3.2.1.106:25	3.2.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	585	796	1.4e-32	0.43157894736842106

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397353	Glyco_hydro_63	0.0	308	798	1	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
407154	Glyco_hydro_63N	2.92e-125	44	266	1	221	Glycosyl hydrolase family 63 N-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the N-terminal beta sandwich domain.
225942	GDB1	1.01e-08	453	750	304	565	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVM12625.1|GH63	0.0	4	811	4	818
QSS68976.1|GH63	0.0	25	810	17	816
QSS50985.1|GH63	0.0	25	810	17	816
QSS63216.1|GH63	0.0	25	810	17	816
QRD84190.1|GH63	0.0	41	811	37	817

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4J5T_A	2.98e-179	41	796	12	800	Crystal structure of Processing alpha-Glucosidase I [Saccharomyces cerevisiae S288C]
5MHF_A	1.94e-135	8	796	7	775	Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
4WVA_A	8.62e-06	599	790	246	412	Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14255|GCS1_SCHPO	3.15e-246	36	796	34	804	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
sp|P53008|CWH41_YEAST	2.97e-178	41	796	42	830	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1
sp|Q80UM7|MOGS_MOUSE	3.40e-136	8	796	62	830	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
sp|O88941|MOGS_RAT	6.85e-131	8	796	62	830	Mannosyl-oligosaccharide glucosidase OS=Rattus norvegicus OX=10116 GN=Mogs PE=1 SV=1
sp|Q13724|MOGS_HUMAN	1.67e-128	8	796	64	833	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.175121	0.824843	CS pos: 26-27. Pr: 0.4450

TMHMM  Annotations     

There is no transmembrane helices in EEQ30320.1.